Lineage for d3jb9b4 (3jb9 B:843-971)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520427Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2520428Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (3 protein domains)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2520505Protein Pre-mRNA splicing factor Cwf10, domains III and V [346096] (1 species)
  7. 2520506Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346362] (1 PDB entry)
  8. 2520508Domain d3jb9b4: 3jb9 B:843-971 [344800]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9b4

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (B:) Pre-mRNA-splicing factor cwf10

SCOPe Domain Sequences for d3jb9b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9b4 d.58.11.1 (B:843-971) Pre-mRNA splicing factor Cwf10, domains III and V {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
epvymvevhapadslpiiydlltrrrghvlqdiprpgsplylvralipvidscgfetdlr
vhtqgqamcqmvfdhwqvvpgdpldksikpkplepargsdlardfliktrrrkglvedvs
ttryfdqem

SCOPe Domain Coordinates for d3jb9b4:

Click to download the PDB-style file with coordinates for d3jb9b4.
(The format of our PDB-style files is described here.)

Timeline for d3jb9b4:

  • d3jb9b4 is new in SCOPe 2.07-stable