Lineage for d3jb9b3 (3jb9 B:596-673)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953555Protein Pre-mRNA splicing factor Cwf10, domain 3 [419080] (1 species)
  7. 2953556Species Schizosaccharomyces pombe 972h- [TaxId:284812] [419572] (1 PDB entry)
  8. 2953557Domain d3jb9b3: 3jb9 B:596-673 [344799]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9b3

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (B:) Pre-mRNA-splicing factor cwf10

SCOPe Domain Sequences for d3jb9b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9b3 d.58.11.1 (B:596-673) Pre-mRNA splicing factor Cwf10, domain 3 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
hmsesvfkvavephnpselpklldglrktnksyplsitkveesgehtifgtgemymdcll
ydlrtlyseieirvsdpv

SCOPe Domain Coordinates for d3jb9b3:

Click to download the PDB-style file with coordinates for d3jb9b3.
(The format of our PDB-style files is described here.)

Timeline for d3jb9b3: