| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.36: Splicing factor Prp8 endonuclease-like domain [345968] (1 protein) Pfam PF10596 Likely homology to endonuclease domains discussed in PubMed 21441348, PubMed 23354046 |
| Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [346085] (2 species) |
| Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346308] (1 PDB entry) |
| Domain d3jb9a2: 3jb9 A:1605-1780 [344793] Other proteins in same PDB: d3jb9a1, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ protein/RNA complex; complexed with adp, gdp, mg, zn |
PDB Entry: 3jb9 (more details), 3.6 Å
SCOPe Domain Sequences for d3jb9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jb9a2 c.52.1.36 (A:1605-1780) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
lwqkihesvvwdlcqvldqeleslqietvqketihprksykmnsscadilllaaykwnvs
rpsllndnrdvldntttnkywidvqlrfgdydshdierytrakfldystdaqsmypsptg
vligidlcynmhsaygnwipgmkpliqqsmnkimkanpalyvlrerirkglqlyas
Timeline for d3jb9a2:
View in 3DDomains from same chain: (mouse over for more information) d3jb9a1, d3jb9a3, d3jb9a4, d3jb9a5 |
View in 3DDomains from other chains: (mouse over for more information) d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ |