![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
![]() | Protein Pre-mRNA splicing factor Prp19 [90223] (2 species) |
![]() | Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346436] (1 PDB entry) |
![]() | Domain d3jb9v1: 3jb9 V:1-57 [344820] Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s2, d3jb9t2, d3jb9u2, d3jb9u3, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ protein/RNA complex; complexed with adp, gdp, mg, zn |
PDB Entry: 3jb9 (more details), 3.6 Å
SCOPe Domain Sequences for d3jb9v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jb9v1 g.44.1.2 (V:1-57) Pre-mRNA splicing factor Prp19 {Schizosaccharomyces pombe 972h- [TaxId: 284812]} mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpd
Timeline for d3jb9v1:
![]() Domains from other chains: (mouse over for more information) d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ |