Lineage for d3jb9a5 (3jb9 A:47-697)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568161Fold d.394: N-terminal domain of Prp8 / Spp42 [345891] (1 superfamily)
    Central core mainly helical with several small beta sheets; also includes Cwf17-binding helix and Cwf10-binding lasso region
  4. 2568162Superfamily d.394.1: N-terminal domain of Prp8 / Spp42 [345924] (1 family) (S)
    Pfam PF08082, Pfam PF08083
  5. 2568163Family d.394.1.1: N-terminal domain of Prp8 / Spp42 [345979] (1 protein)
  6. 2568164Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [346113] (1 species)
  7. 2568165Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346403] (1 PDB entry)
  8. 2568166Domain d3jb9a5: 3jb9 A:47-697 [344796]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9a5

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (A:) Pre-mRNA-splicing factor spp42

SCOPe Domain Sequences for d3jb9a5:

Sequence, based on SEQRES records: (download)

>d3jb9a5 d.394.1.1 (A:47-697) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
lekqlnerarkwrasqkskfgvkrkqgyvqtekadlppehlrkimkdrgdmssrkfradk
rsylgalkylphavlkllenmpmpweeyrevkvlyhvtgaitfvnesprviephfiaqwg
tmwmmmrrekrdrknfkrlrfppfddeeppfsidqlldlepleairmdldeeddapvmdw
fyenkaledtphvngptyrrwklnlpqmanlhrlgyqllsdlrddnyfylfndnsfftak
alnvaipggpkfeplykdeapemedwnefndiykliirhpikteyriafpylynsrarsv
alseyhqpsnvfvppedpdlpaffwdpiinpitsrqltlheldtspedsaieedpnfeip
fdpffhsediefehtasalillwaphpfnkrsgatkraqdvplikhwylehcppnqpvkv
rvsyqkllkshvmnklhmahpkshtnrsllrqlkntkffqstsidwveaglqvcrqgynm
lqllihrkgltylhldyncnlkptktlttkerkksrfgnafhlmreilrltklivdshvq
yrlgnidayqladglhyifnhvgqltgmyrykyrlmrqirackdfkhliyyrfntgpvgk
gpgcgfwapswrvwlfflrgivpllerwlgnllarqfegrhstgvakqitk

Sequence, based on observed residues (ATOM records): (download)

>d3jb9a5 d.394.1.1 (A:47-697) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
lekqlnerarkwrasqkskfgvkrkqgyvqtekadlppehlrkimkdrgdmssrkfradk
rsylgalkylphavlkllenmpmpweeyrevkvlyhvtgaitfvnesprviephfiaqwg
tmwmmmrrekrdrknfkrlrfppfddeeppfsidqlldlepleairmdldeeddapvmdw
fyenkaledtphvngptyrrwklnlpqmanlhrlgyqllsdlrddnyfylfndnsfftak
alnvaipggpkfeplyefndiykliirhpikteyriafpylynsrarsvalseyhqpsnv
fvppedpdlpaffwdpiinpitsrqltlheldtspedsaieedpnfeipfdpffhsedie
fehtasalillwaphpfnkrsgatkraqdvplikhwylehcppnqpvkvrvsyqkllksh
vmnklhmahpkshtnrsllrqlkntkffqstsidwveaglqvcrqgynmlqllihrkglt
ylhldyncnlkptktlttkerkksrfgnafhlmreilrltklivdshvqyrlgnidayql
adglhyifnhvgqltgmyrykyrlmrqirackdfkhliyyrfntgpvgkgpgcgfwapsw
rvwlfflrgivpllerwlgnllarqfegrhstgvakqitk

SCOPe Domain Coordinates for d3jb9a5:

Click to download the PDB-style file with coordinates for d3jb9a5.
(The format of our PDB-style files is described here.)

Timeline for d3jb9a5:

  • d3jb9a5 is new in SCOPe 2.07-stable