Lineage for d3jb9x4 (3jb9 X:1045-1284)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451114Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 protein domains)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2451219Protein Pre-mRNA splicing factor Cwf11 / Aquarius [346069] (2 species)
    first domain includes 'stalk' (C-terminal part of Pfam PF16399), 'thumb' and 'pointer' insert subdomains described in PubMed 25599396
  7. 2451223Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346288] (1 PDB entry)
  8. 2451225Domain d3jb9x4: 3jb9 X:1045-1284 [344826]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9x4

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (X:) Pre-mRNA-splicing factor cwf11

SCOPe Domain Sequences for d3jb9x4:

Sequence, based on SEQRES records: (download)

>d3jb9x4 c.37.1.19 (X:1045-1284) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
qynvresisslcssiypldiktvdsspnkrldygnsgfahevqfinvgafkgsqetepvs
gykqnlgeaeyavalfqymrmlgyptneivictlyesqvsllneiisvrcshnsffgqpa
fvgtveklpsdkrvnfvifttveskeasdhwnpktfykafsacsyglyvlcnrdlfrstr
gleklwneiektpdklllttgeiypsshkigssvetfeienllhlsnyvvemtkkrlntn

Sequence, based on observed residues (ATOM records): (download)

>d3jb9x4 c.37.1.19 (X:1045-1284) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
qynvresisslcssiypldiktvdsspnkrldygnsgfahevqfinvgafkgsqetepvs
gykqnlgeaeyavalfqymrmlgyptneivictlyesqvsllneiisvrcshnsffgqpa
fvgtveklpkrvnfvifttveskeasdhwnpktfykafsacsyglyvlcnrdlfrstrgl
eklwneiektpdklllttgeiypsshssvetfeienllhlsnyvvemtkkrlntn

SCOPe Domain Coordinates for d3jb9x4:

Click to download the PDB-style file with coordinates for d3jb9x4.
(The format of our PDB-style files is described here.)

Timeline for d3jb9x4:

  • d3jb9x4 is new in SCOPe 2.07-stable