Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.40: Pre-mRNA splicing factor Prp19 coiled coil domain [345934] (2 families) Pfam PF08606 |
Family h.1.40.1: Pre-mRNA splicing factor Prp19-like [345992] (1 protein) |
Protein Pre-mRNA splicing factor Prp19 [346135] (1 species) |
Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346449] (1 PDB entry) |
Domain d3jb9s2: 3jb9 S:58-132 [344814] Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9t1, d3jb9u1, d3jb9u3, d3jb9v1, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ protein/RNA complex; complexed with adp, gdp, mg, zn |
PDB Entry: 3jb9 (more details), 3.6 Å
SCOPe Domain Sequences for d3jb9s2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jb9s2 h.1.40.1 (S:58-132) Pre-mRNA splicing factor Prp19 {Schizosaccharomyces pombe 972h- [TaxId: 284812]} fvrprppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisr ltkerdearealakf
Timeline for d3jb9s2:
View in 3D Domains from other chains: (mouse over for more information) d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ |