Lineage for d3jb9s2 (3jb9 S:58-132)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591536Superfamily h.1.40: Pre-mRNA splicing factor Prp19 coiled coil domain [345934] (1 family) (S)
    Pfam PF08606
  5. 2591537Family h.1.40.1: Pre-mRNA splicing factor Prp19-like [345992] (1 protein)
  6. 2591538Protein Pre-mRNA splicing factor Prp19 [346135] (1 species)
  7. 2591539Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346449] (1 PDB entry)
  8. 2591540Domain d3jb9s2: 3jb9 S:58-132 [344814]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9t1, d3jb9u1, d3jb9u3, d3jb9v1, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9s2

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (S:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d3jb9s2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9s2 h.1.40.1 (S:58-132) Pre-mRNA splicing factor Prp19 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
fvrprppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisr
ltkerdearealakf

SCOPe Domain Coordinates for d3jb9s2:

Click to download the PDB-style file with coordinates for d3jb9s2.
(The format of our PDB-style files is described here.)

Timeline for d3jb9s2:

  • d3jb9s2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3jb9s1