SCOPe 2.08: Domain d3jb9a1: 3jb9 A:1784-2030

Lineage for d3jb9a1 (3jb9 A:1784-2030)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
   automatically mapped to Pfam PF12134

6. Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)

7. Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346311] (1 PDB entry)

8. Domain d3jb9a1: 3jb9 A:1784-2030 [344792]
   Other proteins in same PDB: d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
   protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9a1

PDB Entry: 3jb9, 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution

PDB Compounds: (A:) Pre-mRNA-splicing factor spp42

SCOPe Domain Sequences for d3jb9a1:

Sequence; same for both SEQRES and ATOM records:

>d3jb9a1 c.55.3.14 (A:1784-2030) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
eqylsssnyaelfsnqiqlfvddtnvyrvtihktfegnlttkpingaififnprtgqlfl
kvihtsvwagqkrlgqlakwktaeevaalirslpveeqprqiivtrkgmldplevhlldf
pnitikgselqlpfqaiikldkindlilratepqmvlfnlyddwlqsvssytafsrlili
lralnvntektklilrpdksiitkenhvwpnlddqqwldvepklrdliladyakknninv
asltnse

Timeline for d3jb9a1:

• d3jb9a1 first appeared in SCOPe 2.07