SCOPe 2.08: Domain d3jb9t2: 3jb9 T:58-134

Lineage for d3jb9t2 (3jb9 T:58-134)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.40: Pre-mRNA splicing factor Prp19 coiled coil domain [345934] (2 families)
   Pfam PF08606

5. Family h.1.40.1: Pre-mRNA splicing factor Prp19-like [345992] (1 protein)

6. Protein Pre-mRNA splicing factor Prp19 [346135] (1 species)

7. Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346449] (1 PDB entry)

8. Domain d3jb9t2: 3jb9 T:58-134 [344816]
   Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9t1, d3jb9u1, d3jb9u3, d3jb9v1, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
   protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9t2

PDB Entry: 3jb9, 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution

PDB Compounds: (T:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d3jb9t2:

Sequence; same for both SEQRES and ATOM records:

>d3jb9t2 h.1.40.1 (T:58-134) Pre-mRNA splicing factor Prp19 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
fvrprppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisr
ltkerdearealakfsd

Timeline for d3jb9t2:

• d3jb9t2 first appeared in SCOPe 2.07