Lineage for d3jb9z_ (3jb9 Z:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2787019Protein D3 core SNRNP protein [50188] (3 species)
  7. 2787030Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346234] (1 PDB entry)
    3jb9 chain D is also D3 subunit; not included because sids are not case sensitive
  8. 2787031Domain d3jb9z_: 3jb9 Z: [344829]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9z_

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (Z:) Small nuclear ribonucleoprotein Sm D3

SCOPe Domain Sequences for d3jb9z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9z_ b.38.1.1 (Z:) D3 core SNRNP protein {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
slcikllhetqghivtmelengstyrgklieaednmncqmrdisvtardgrvshldqvyi
rgshirflivpdmlrnapmf

SCOPe Domain Coordinates for d3jb9z_:

Click to download the PDB-style file with coordinates for d3jb9z_.
(The format of our PDB-style files is described here.)

Timeline for d3jb9z_: