PDB entry 3jb9

View 3jb9 on RCSB PDB site
Description: Cryo-EM structure of the yeast spliceosome at 3.6 angstrom resolution
Class: RNA binding protein/RNA
Keywords: Spliceosome, U2/U5/U6, Lariat, RNA BINDING PROTEIN-RNA complex
Deposited on 2015-08-09, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: EM
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor spp42
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5
  • Chain 'B':
    Compound: Pre-mRNA-splicing factor cwf10
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5
  • Chain 'C':
    Compound: U5 snRNA
    Species: Schizosaccharomyces pombe [TaxId:4896]
  • Chain 'D':
    Compound: Small nuclear ribonucleoprotein Sm D3
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Small nuclear ribonucleoprotein-associated protein B
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9f_
  • Chain 'G':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Small nuclear ribonucleoprotein E
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Small nuclear ribonucleoprotein F
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Small nuclear ribonucleoprotein G
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9j_
  • Chain 'K':
    Compound: Pre-mRNA-splicing factor prp5
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JB9
    • Uniprot O13615 (148-End)
    Domains in SCOPe 2.07: d3jb9k_
  • Chain 'L':
    Compound: Pre-mRNA-splicing factor cwf17
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9l_
  • Chain 'M':
    Compound: Pre-mRNA-processing protein 45
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9m_
  • Chain 'N':
    Compound: U6 snRNA
    Species: Schizosaccharomyces pombe [TaxId:4896]
  • Chain 'O':
    Compound: RNA (5'-r(p*gp*up*ap*up*gp*up*ap*u)-3')
    Species: Schizosaccharomyces pombe [TaxId:4896]
  • Chain 'P':
    Compound: U2 snRNA
    Species: Schizosaccharomyces pombe [TaxId:4896]
  • Chain 'Q':
    Compound: RNA (5'-r(p*up*up*up*ap*up*ap*cp*up*ap*ap*cp*ap*c)-3')
    Species: Schizosaccharomyces pombe [TaxId:4896]
  • Chain 'R':
    Compound: Pre-mRNA-splicing factor cwf4
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JB9
    • Uniprot P87312 (40-289)
    • PDB 3JB9
    Domains in SCOPe 2.07: d3jb9r_
  • Chain 'S':
    Compound: Pre-mRNA-processing factor 19
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9s1, d3jb9s2
  • Chain 'T':
    Compound: Pre-mRNA-processing factor 19
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9t1, d3jb9t2
  • Chain 'U':
    Compound: Pre-mRNA-processing factor 19
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9u1, d3jb9u2, d3jb9u3
  • Chain 'V':
    Compound: Pre-mRNA-processing factor 19
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9v1, d3jb9v2
  • Chain 'W':
    Compound: Pre-mRNA-splicing factor cdc5
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39964 (Start-235)
    • PDB 3JB9
    • Uniprot P39964 (651-756)
    Domains in SCOPe 2.07: d3jb9w_
  • Chain 'X':
    Compound: Pre-mRNA-splicing factor cwf11
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4
  • Chain 'Y':
    Compound: Pre-mRNA-splicing factor cwf2
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P87126 (Start-288)
    • PDB 3JB9
    Domains in SCOPe 2.07: d3jb9y1, d3jb9y2
  • Chain 'Z':
    Compound: Small nuclear ribonucleoprotein Sm D3
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9z_
  • Chain 'a':
    Compound: Pre-mRNA-splicing factor cwf5
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59800 (Start-150)
    • PDB 3JB9
    • Uniprot O59800 (177-284)
    • PDB 3JB9
  • Chain 'b':
    Compound: Small nuclear ribonucleoprotein-associated protein B
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Pre-mRNA-splicing factor cwf19
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9c_
  • Chain 'd':
    Compound: Peptidyl-prolyl cis-trans isomerase ppi1
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Pre-mRNA-splicing factor cwf14
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9e_
  • Chain 'f':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Pre-mRNA-processing factor 17
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9g_
  • Chain 'h':
    Compound: Pre-mRNA-splicing factor cwf15
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9h_
  • Chain 'i':
    Compound: Pre-mRNA-splicing factor cwf7
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jb9i_
  • Chain 'j':
    Compound: U2 small nuclear ribonucleoprotein A'
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Probable U2 small nuclear ribonucleoprotein B''
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Small nuclear ribonucleoprotein E
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Small nuclear ribonucleoprotein F
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Small nuclear ribonucleoprotein G
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Pre-mRNA-splicing factor cwf3
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JB9
    • Uniprot Q9P7R9 (497-652)
    • PDB 3JB9
  • Chain 'x':
    Compound: unknown chain
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JB9 (Start-411)
  • Heterogens: GDP, MG, ZN, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jb9A (A:)
    maslppgnppppppppgfeppsqpppppppgyvkkrknktpaqsgnlekqlnerarkwra
    sqkskfgvkrkqgyvqtekadlppehlrkimkdrgdmssrkfradkrsylgalkylphav
    lkllenmpmpweeyrevkvlyhvtgaitfvnesprviephfiaqwgtmwmmmrrekrdrk
    nfkrlrfppfddeeppfsidqlldlepleairmdldeeddapvmdwfyenkaledtphvn
    gptyrrwklnlpqmanlhrlgyqllsdlrddnyfylfndnsfftakalnvaipggpkfep
    lykdeapemedwnefndiykliirhpikteyriafpylynsrarsvalseyhqpsnvfvp
    pedpdlpaffwdpiinpitsrqltlheldtspedsaieedpnfeipfdpffhsediefeh
    tasalillwaphpfnkrsgatkraqdvplikhwylehcppnqpvkvrvsyqkllkshvmn
    klhmahpkshtnrsllrqlkntkffqstsidwveaglqvcrqgynmlqllihrkgltylh
    ldyncnlkptktlttkerkksrfgnafhlmreilrltklivdshvqyrlgnidayqladg
    lhyifnhvgqltgmyrykyrlmrqirackdfkhliyyrfntgpvgkgpgcgfwapswrvw
    lfflrgivpllerwlgnllarqfegrhstgvakqitkqrvdshqdlelraavmndildmi
    pegirqgksktilqhlseawrcwkanipwkvpglpapienmilryvkskadwwtsvahfn
    rerirrgatvdktvakknlgrltrlwlkaeqerqhnylkdgpyvtadeavaiyttfvhwl
    esrrfqpipfpplsykhdtkllvlalerlkeaysvkgrlnqsqreelalveqaydnphem
    lsqikrrlltmrtfkevgiefmdmyshlipvysvdpmekicdayldqylwfeadrrhlfp
    swvkpsdsepppllvykwcqginnltdvwetsngecnvlmetrlskvfekvdltllnrlm
    sllmdtnlasyasaknnvvlsykdmshtnsyglvrglqfssfiwqfyglvldllilglqr
    ateiagpadapndflhfkdqatetshpirlytryidkvyimfrftdeesrdliqrflnen
    pdptnsnvvnyskgkkncwprdarmrlmkhdvnlgravfweirnrlprslttlewedtfp
    svyskdnpnllfsmtgfevrilpkirqneefslkdgvwnltdnrtkqrtaqafirvtedg
    inqfgnrirqilmssgsttftkiankwntalialmtyyreaaistpelldllvkceskiq
    trvkislnskmpsrfppavfyspkelgglgmlsmghvlipqsdlrwskqtdtgithfrsg
    mttngehlipnlyryiqpwesefidsqrvwaeyamkrqealqqnrrltledledswdrgi
    printlfqkdrhtlaydkgwrvrtefkqyqllknnpfwwtsqrhdgklwqlnnyrvdviq
    alggvegilehtmfkatgfpsweglfwekasgfeesmkfkkltnaqrsglnqipnrrftl
    wwsptinranvyvgfqvqldltgimmhgkiptlkisliqifrshlwqkihesvvwdlcqv
    ldqeleslqietvqketihprksykmnsscadilllaaykwnvsrpsllndnrdvldntt
    tnkywidvqlrfgdydshdierytrakfldystdaqsmypsptgvligidlcynmhsayg
    nwipgmkpliqqsmnkimkanpalyvlrerirkglqlyasepqeqylsssnyaelfsnqi
    qlfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkvihtsvwagqkrlgql
    akwktaeevaalirslpveeqprqiivtrkgmldplevhlldfpnitikgselqlpfqai
    ikldkindlilratepqmvlfnlyddwlqsvssytafsrlililralnvntektklilrp
    dksiitkenhvwpnlddqqwldvepklrdliladyakknninvasltnsevrdiilgmti
    tapslqrqqiaeiekqgrenaqvtavttkttnvhgdemvvtttsayenekfssktewrnr
    aissislplrtkniyvnsdnisetfpytyilpqnllrkfvtisdlrtqvagymygkspsd
    npqikeircialvpqlgsirnvqlpsklphdlqpsiledleplgwihtqsselpylssvd
    vtthakilsshpewdtkavtltvsyipgsislaaytvskegiewgsknmdinsdeaigye
    psmaekcqlllsdriqgfflvpeegvwnynfngasfspkmtyslkldvplpffalehrpt
    hvisyteletndrleedmpdafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9A (A:)
    lekqlnerarkwrasqkskfgvkrkqgyvqtekadlppehlrkimkdrgdmssrkfradk
    rsylgalkylphavlkllenmpmpweeyrevkvlyhvtgaitfvnesprviephfiaqwg
    tmwmmmrrekrdrknfkrlrfppfddeeppfsidqlldlepleairmdldeeddapvmdw
    fyenkaledtphvngptyrrwklnlpqmanlhrlgyqllsdlrddnyfylfndnsfftak
    alnvaipggpkfeplyefndiykliirhpikteyriafpylynsrarsvalseyhqpsnv
    fvppedpdlpaffwdpiinpitsrqltlheldtspedsaieedpnfeipfdpffhsedie
    fehtasalillwaphpfnkrsgatkraqdvplikhwylehcppnqpvkvrvsyqkllksh
    vmnklhmahpkshtnrsllrqlkntkffqstsidwveaglqvcrqgynmlqllihrkglt
    ylhldyncnlkptktlttkerkksrfgnafhlmreilrltklivdshvqyrlgnidayql
    adglhyifnhvgqltgmyrykyrlmrqirackdfkhliyyrfntgpvgkgpgcgfwapsw
    rvwlfflrgivpllerwlgnllarqfegrhstgvakqitkqrvdshqdlelraavmndil
    dmipegirqgksktilqhlseawrcwkanipwkvpglpapienmilryvkskadwwtsva
    hfnrerirrgatvdktvakknlgrltrlwlkaeqerqhnylkdgpyvtadeavaiyttfv
    hwlesrrfqpipfpplsykhdtkllvlalerlkeaysvkgrlnqsqreelalveqaydnp
    hemlsqikrrlltmrtfkevgiefmdmyshlipvysvdpmekicdayldqylwfeadrrh
    lfpswvkpsdsepppllvykwcqginnltdvwetsngecnvlmetrlskvfekvdltlln
    rlmsllmdtnlasyasaknnvvlsykdmshtnsyglvrglqfssfiwqfyglvldllilg
    lqrateiagpadapndflhfkdqatetshpirlytryidkvyimfrftdeesrdliqrfl
    nenpdptnsnvvnyskgkkncwprdarmrlmkhdvnlgravfweirnrlprslttlewed
    tfpsvyskdnpnllfsmtgfevrilpkirqneefslkdgvwnltdnrtkqrtaqafirvt
    edginqfgnrirqilmssgsttftkiankwntalialmtyyreaaistpelldllvkces
    kiqtrvkislnskmpsrfppavfyspkelgglgmlsmghvlipqsdlrwskqtdtgithf
    rsgmttngehlipnlyryiqpwesefidsqrvwaeyamkrqealqqnrrltledledswd
    rgiprintlfqkdrhtlaydkgwrvrtefkqyqllknnpfwwtsqrhdgklwqlnnyrvd
    viqalggvegilehtmfkatgfpsweglfwekasgfkkltnaqrsglnqipnrrftlwws
    ptinranvyvgfqvqldltgimmhgkiptlkisliqifrshlwqkihesvvwdlcqvldq
    eleslqietvqketihprksykmnsscadilllaaykwnvsrpsllndnrdvldntttnk
    ywidvqlrfgdydshdierytrakfldystdaqsmypsptgvligidlcynmhsaygnwi
    pgmkpliqqsmnkimkanpalyvlrerirkglqlyaseqylsssnyaelfsnqiqlfvdd
    tnvyrvtihktfegnlttkpingaififnprtgqlflkvihtsvwagqkrlgqlakwkta
    eevaalirslpveeqprqiivtrkgmldplevhlldfpnitikgselqlpfqaiikldki
    ndlilratepqmvlfnlyddwlqsvssytafsrlililralnvntektklilrpdksiit
    kenhvwpnlddqqwldvepklrdliladyakknninvasltnse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jb9B (B:)
    mmeedlydefgnyigpeneedeeelfpqapsptiaqvpsfeevipdeeledveraeemal
    shlepqnavvlhedkqyypsaeevygsnvdimvqeqdtqplsqpiiepirhkriaiettn
    vpdtvykkeflfglltgtddvrsfivaghlhhgksalldllvyythpdtkppkrrslryt
    dthylerervmsikstpltlavsdmkgktfafqcidtpghvdfvdevaapmaisdgvvlv
    vdviegvminttriikhailhdmpivlvlnkvdrlilelrlppndayhklrhvidevndn
    icqiskdlkyrvspelgnvcfascdlgycftlssfaklyidrhggidvdlfskrlwgdiy
    fdsktrkfakqsldgsgvrsfvhfileplyklhtltisdeaeklkkhlssfqiylkpkdy
    lldpkpllqlicasffgfpvgfvnavtrhipsprenaarkasqsyigpinssigkailem
    sreesaplvmhvtklyntvdannfyafarvysgqvkkgqkvkvlgenysledeedmvvah
    iaeicvpcaryrlhvdgavagmlvllggvdnsisktativsdnlkddpyifrpiahmses
    vfkvavephnpselpklldglrktnksyplsitkveesgehtifgtgemymdcllydlrt
    lyseieirvsdpvarfcetavdtssikcfsdtpnkknritmvveplekgisndiengkvn
    inwpqkriseffqknydwdllasrsiwafgpddrgtnilrddtlstdvdknvlnsvkeyi
    kqgfqwgtregplcdetirnvnfrlmdvvlapeqiyrgggqiiptarrvcyssfltaspr
    lmepvymvevhapadslpiiydlltrrrghvlqdiprpgsplylvralipvidscgfetd
    lrvhtqgqamcqmvfdhwqvvpgdpldksikpkplepargsdlardfliktrrrkglved
    vsttryfdqemidslkeagvvlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9B (B:)
    avvlhedkqyypsaeevygsnvdimvqeqdtqplsqpiiepirhkriaiettnvpdtvyk
    keflfglltgtddvrsfivaghlhhgksalldllvyythpdtkppkrrslrytdthyler
    ervmsikstpltlavsdmkgktfafqcidtpghvdfvdevaapmaisdgvvlvvdviegv
    minttriikhailhdmpivlvlnkvdrlilelrlppndayhklrhvidevndnicqiskd
    lkyrvspelgnvcfascdlgycftlssfaklyidrhggidvdlfskrlwgdiyfdsktrk
    fakqsldgsgvrsfvhfileplyklhtltisdeaeklkkhlssfqiylkpkdylldpkpl
    lqlicasffgfpvgfvnavtrhipsprenaarkasqsyigpinssigkailemsreesap
    lvmhvtklyntvdannfyafarvysgqvkkgqkvkvlgenysledeedmvvahiaeicvp
    caryrlhvdgavagmlvllggvdnsisktativsdnlkddpyifrpiahmsesvfkvave
    phnpselpklldglrktnksyplsitkveesgehtifgtgemymdcllydlrtlyseiei
    rvsdpvarfcetavdtssikcfsdtpnkknritmvveplekgisndiengkvninwpqkr
    iseffqknydwdllasrsiwafgpddrgtnilrddtlstdvdknvlnsvkeyikqgfqwg
    tregplcdetirnvnfrlmdvvlapeqiyrgggqiiptarrvcyssfltasprlmepvym
    vevhapadslpiiydlltrrrghvlqdiprpgsplylvralipvidscgfetdlrvhtqg
    qamcqmvfdhwqvvpgdpldksikpkplepargsdlardfliktrrrkglvedvsttryf
    dqem
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3jb9F (F:)
    mklvrflmkltnetvsielkngtivhgtitsvdmqmnthlkavkmtvkgrepvpvetlsi
    rgnniryyilpdslpldtlliddstkpkqkkkevvrgrgrgrgrgtrgrgrgasrgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9F (F:)
    mklvrflmkltnetvsielkngtivhgtitsvdmqmnthlkavkmtvkgrepvpvetlsi
    rgnniryyilpdslpldtllid
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3jb9J (J:)
    mskagapdlkkyldrqvfvqlngsrkvygvlrgydiflnivledsieekvdgekvkigsv
    airgnsvimietldkmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9J (J:)
    kagapdlkkyldrqvfvqlngsrkvygvlrgydiflnivledsieekvdgekvkigsvai
    rgnsvimietldk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3jb9K (K:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxwhapwtlmrvisghlgwvrcvdvepgnqwfct
    gagdrtikiwdlasgvlkltltghiatvrglavsprhpylfscgedkmvkcwdletnkvi
    rhyhghlsgvyalklhptldvlvtagrdavarvwdmrtrqnvhvlsghkstvaslavqef
    dpqvvtgsmdstirlwdlaagktlttlthhkktvralslhpdeftfasgssdnikhwkfp
    egafmgnfeghnaivntlsinsdnvmfsgadngsmcfwdwksghkyqelqsvvqpgslds
    eagifassfdktglrlitceadksvkiykqvdnatpethpnlpwtpsnlrrry
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9K (K:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxwhapwtlmr
    visghlgwvrcvdvepgnqwfctgagdrtikiwdlasgvlkltltghiatvrglavsprh
    pylfscgedkmvkcwdletnkvirhyhghlsgvyalklhptldvlvtagrdavarvwdmr
    trqnvhvlsghkstvaslavqefdpqvvtgsmdstirlwdlaagktlttlthhkktvral
    slhpdeftfasgssdnikhwkfpegafmgnfeghnaivntlsinsdnvmfsgadngsmcf
    wdwksghkyqelqsvvqpgsldseagifassfdktglrlitceadksvkiykqvdnatpe
    thpnlpwtpsnlr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3jb9L (L:)
    mdkrkesesatnghlvkririqdsslitegsvlqrtsdlnvpnlqmfghtaevlvarfdp
    sgsyfasggmdrqillwnvfgdvknygvlngckgaitdlqwsrdsrvvycsssdthlmsw
    davsgqkirkhkghagvvnaldvlkvgselltsvsddctmkvwdsrskdciktieekypl
    tavaiaqqgtqvfiggidgaikiwdlrnnhcshvlkghkdiitslaiskdgssllsnsmd
    ntvrifdvkpfasaqrqlqifegaihgqehnllgvawsrnsrfvgagssdknvyvwsatg
    dlryvlpghegsvnhvdfhphqdiilscssdrtiflgeln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9L (L:)
    pnlqmfghtaevlvarfdpsgsyfasggmdrqillwnvfdvknygvlngckgaitdlqws
    rdsrvvycsssdthlmswdavsgqkirkhkghagvvnaldvlkvselltsvsddctmkvw
    dsrskdciktieekypltavaiaqqgtqvfiggidgaikiwdlrnnhcshvlkghkdiit
    slaiskdgssllsnsmdntvrifdvkaqrqlqifegaihgqehnllgvawsrnsrfvgag
    ssdknvyvwsatgdlryvlpghegsvnhvdfhphqdiilscssdrtiflgeln
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3jb9M (M:)
    mallseelssilpnpdfddeeedyveretshaderqigvkfhippygqrkgwfpsspedf
    gdggafpeihvaqypldmgrkrsaksagntlalqvtssgavdynaiarqghehgelvqas
    frdliplrarlgvgeislekpsdeqkqevanktklalqkilskqiaqsqpksavvqqrdd
    pvyirytpsnqmgqalskqriikmvtaeqdpmeppkfrhkkvprgppsppppvlhspprk
    vsaqeqqdwqippsisnwknpkgytipldkrlaadgrglndveindgfakfsealytver
    qareevryraimrqkmaekekqekeqrlfmlaqkaredrmgrnaassgpshakprstsvs
    seersrsragsfshhsesenededseafrrrqelrrerrrqaekdlrlsrmgaekrakla
    ekdrprdvaervalglskpsmssdtmidsrlfnqasglgsgfqdedsynvydkpwraaps
    stlyrpgatlsrqvdasaeleritsesrydvlgnahkkfkgsdevvesragpvtfekdia
    dpfgvdtflnnvsskkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9M (M:)
    avdynaiarqghehgelvqasfrdliplrarlgvgeislekpsdeqkqevanktklalqk
    ilskqiaqsqpksavvqqrddpvyirytpsnqmgqalskqriikmvtaeqdpmeppkfrh
    kkvprgppsppppvlhspprkvsaqeqqdwqippsisnwknpkgytipldkrdveindgf
    akfsealytverqareevryraimrqk
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3jb9R (R:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxnitdleelqefqgrkrkefe
    dairrnrlamghwmrygqweldqkefararsvferaldvdstyiplwlkyiecemknrni
    nharnlfdravtqlprvdklwykyvymeemlgnitgcrqvferwlkwepdencwmsyirm
    erryhenerargiyerfvvvhpevtnwlrwarfeeecgnaanvrqvylaaidalgqefln
    erffiafakfeirqkeyerartifkyaidfmprsksmelykeythfekqfxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9R (R:)
    xxxxxxxxxxxxxxxxnitdleelqefqgrkrkefedairrnrlamghwmrygqweldqk
    efararsvferaldvdstyiplwlkyiecemknrninharnlfdravtqlprvdklwyky
    vymeemlgnitgcrqvferwlkwepdencwmsyirmerryhenerargiyerfvvvhpev
    tnwlrwarfeeecgnaanvrqvylaaidalgqeflnerffiafakfeirqkeyerartif
    kyaidfmprsksmelykeythfekqfxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3jb9S (S:)
    mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpdfvr
    prppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisrltk
    erdearealakfsdnigtvssktievqevemgesddqlktslrstvektfqelsskrkrt
    klqpkwatddavsqllqatpstilenletesttsffpspenssfvlclhkdellcldiqs
    nstlkifegsalaccwltsskiavatadaisifefpvsssglqsvgeptssipidekvnf
    lqahpsgeyllaasnekcyifslksqvynitvaqhitslavhpdgnlfvaglengelrff
    etssgneltkfgphsspvktlqfgengywlvvttnddsdifiwdlrkselvqkiplqtkv
    aavslditsqllvssdgetlyvhiyvksskswrcmsqthvssisnlvwlnelhqllfsts
    ngailrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9S (S:)
    mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpdfvr
    prppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisrltk
    erdearealakf
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3jb9T (T:)
    mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpdfvr
    prppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisrltk
    erdearealakfsdnigtvssktievqevemgesddqlktslrstvektfqelsskrkrt
    klqpkwatddavsqllqatpstilenletesttsffpspenssfvlclhkdellcldiqs
    nstlkifegsalaccwltsskiavatadaisifefpvsssglqsvgeptssipidekvnf
    lqahpsgeyllaasnekcyifslksqvynitvaqhitslavhpdgnlfvaglengelrff
    etssgneltkfgphsspvktlqfgengywlvvttnddsdifiwdlrkselvqkiplqtkv
    aavslditsqllvssdgetlyvhiyvksskswrcmsqthvssisnlvwlnelhqllfsts
    ngailrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9T (T:)
    mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpdfvr
    prppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisrltk
    erdearealakfsd
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3jb9U (U:)
    mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpdfvr
    prppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisrltk
    erdearealakfsdnigtvssktievqevemgesddqlktslrstvektfqelsskrkrt
    klqpkwatddavsqllqatpstilenletesttsffpspenssfvlclhkdellcldiqs
    nstlkifegsalaccwltsskiavatadaisifefpvsssglqsvgeptssipidekvnf
    lqahpsgeyllaasnekcyifslksqvynitvaqhitslavhpdgnlfvaglengelrff
    etssgneltkfgphsspvktlqfgengywlvvttnddsdifiwdlrkselvqkiplqtkv
    aavslditsqllvssdgetlyvhiyvksskswrcmsqthvssisnlvwlnelhqllfsts
    ngailrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9U (U:)
    mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpdfvr
    prppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisrltk
    erdearealakfsdnlsskrkrtklqpkwatddavsqllqatpstilenletesttsffp
    spenssfvlclhkdellcldiqsegsalaccwltsskiavatadaisifefpvsssglqs
    vgeidekvnflqahpsgeyllaasnekcyifsksqvynitvaqhitslavhpdgnlfvag
    lengelrffetssgneltkfgphsspvktlqfgengywlvvttnsdifiwdlrkselvqk
    iplqtkvaavslditqllvssdgetlyvhiyvksrcmsqthvssisnlvwlnelhqllfs
    tsngailrlg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3jb9V (V:)
    mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpdfvr
    prppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisrltk
    erdearealakfsdnigtvssktievqevemgesddqlktslrstvektfqelsskrkrt
    klqpkwatddavsqllqatpstilenletesttsffpspenssfvlclhkdellcldiqs
    nstlkifegsalaccwltsskiavatadaisifefpvsssglqsvgeptssipidekvnf
    lqahpsgeyllaasnekcyifslksqvynitvaqhitslavhpdgnlfvaglengelrff
    etssgneltkfgphsspvktlqfgengywlvvttnddsdifiwdlrkselvqkiplqtkv
    aavslditsqllvssdgetlyvhiyvksskswrcmsqthvssisnlvwlnelhqllfsts
    ngailrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9V (V:)
    mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpdfvr
    prppsatslpallslfqeewdsvaleqfelrrnltetkqelstalysldaalrvisrltk
    erdearealak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3jb9W (W:)
    mvvlkggawkntedeilkaavskygknqwarissllvrktpkqckarwyewidpsikkte
    wsreedekllhlakllptqwrtiapivgrtatqcleryqkllddleakeneqlglisgeg
    aeaaapvndpnsrlrfgeaepnletlpalpdaidmdedekemlseararlantqgkkakr
    kdrekqleltrrlshlqkrrelkaaginiklfrrkknemdynasipfekkpaigfyxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxaaekfytnd
    iqrdlakkalecnklenrvydlvrssyeqrnflikkishawkalqterknltcyeflynq
    erlalpnrleaaeielskmqqieayaqqdyarvtgqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9W (W:)
    awkntedeilkaavskygknqwarissllvrktpkqckarwyewidpsikktewsreede
    kllhlakllptqwrtiapivgrtatqcleryqkllddleakedmdedekemlseararla
    ntqgkkakrkdrekqleltrrlshlqkrrelkynasipfekkpaigfyxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxaaekfytndiqrdlakkalecnklenrvydlvrssyeqrn
    flikkishawkalqterknltcyeflynqerlalpnrleaaeielskmqqieayaqqdya
    rvtgqn
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3jb9X (X:)
    mvlyknkkkqiinyansnwgqnegvefqetmlqcileavivskdakqvlsllhelklfen
    flwqrvntemslnhinltcmlllykskyeyitwdlidenrfqlffekvievslslnlsev
    vymiqfitlcfqfsnieklrklvyqltnisilnsldnldkvkyllhdsssltkafdsyke
    krpsivekfplhnllsrwihslliksisyaqtekqeakvtpllaiinmslvllsafptrr
    fahpviedscfytalrmslyydsnelfkkmtddlnyvlkfpfdntrgneyekeqkirnde
    lvyyhlqltlfsdfqkelgdlvfctqtslqqrqkleeitsflsfnslkslcskcylrtsf
    pekyaikvdfeflknvfintydrtrlvndydeiinftlkdvlgersvmdqensltnyfll
    qntaiqylsisffmrqqskaykklllrslyaellnfseqyrrlsiknatknltkdnffsl
    nnfkvtsvappqigqvlpqfvkcqmglsrpgpfhsalrdlknsikspflcliyiskdmey
    kllhgnaldplegvtdftiaticnddvgmfqsdmqsdsdnksinvylspfyyhslaglge
    yrpkqlkfnfalvlspeankywldlnilvsllnrakefpkwfedlflgfgtpdicafpna
    glnsiyarnlfntveqlqsvlpnchvpsnlstesllikfytnqnkisadvtasdrhfllp
    snrlytyndkqlesilrgsqpgltmvngptrcgkhvlvckllevlqdtspndrtvvlsds
    nfsmntlftllekarcfhqghllylsdegkdetlerygtlsswisklpgllreigrlaas
    iqapgshdaspdtalyfrdayikrlwekylntvddkdsvdaynrfpfhsyfgdkskrpie
    tynkdnffdyatklygeleymfqqleeirpfgllryyedqelyalcqqsriigctwtsls
    trlgtlkekgfcfnnlivmnsqnisessitsillsnceptgfdrlvllgnqyltsgnqdi
    nntsngslfkrlrylksriidlntqynvresisslcssiypldiktvdsspnkrldygns
    gfahevqfinvgafkgsqetepvsgykqnlgeaeyavalfqymrmlgyptneivictlye
    sqvsllneiisvrcshnsffgqpafvgtveklpsdkrvnfvifttveskeasdhwnpktf
    ykafsacsyglyvlcnrdlfrstrgleklwneiektpdklllttgeiypsshkigssvet
    feienllhlsnyvvemtkkrlntn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9X (X:)
    kkkqiinyansnwgegvefqetmlqcileavivsakqvlsllhelklfenflwqrvntem
    slnhinltcmlllykskyeyitwdlinrfqlffekvievslslnlsevvymiqfitlcfq
    fsnieklrklvyqltnisilnslldkvkyllhdsssltkafdsykekrpvekfplhnlls
    rwihslliksisyaqkqeakvtpllaiinmslvllsafptrrfahpviedscfytalrms
    lyydsnelfkkmtddlnyvlkfpfdntrgneyekeqkirndelvyyhlqltlfsdfqlqq
    rqkleeitsflsfnslkslcskcylrtsfpekyaikvdfeflknvfintydrrlvndyde
    iinftlkdvlgersvmdqensltntaiqylsisffmrqqskaykklllrslyaellnfse
    qyrrlsiknatknlnffslnnfkvtsvaplpqfvkcqmglsrpsalrdlknsspflcliy
    iskdmeykllhgnaldplevtdftiaticnddvgmfmqsdsdnksinvylspfyyhslag
    lgeyrpkqlkfnfalvlsnkywldlnilvsllnrakefpkwfedlflgfgtpdicafpna
    nsiyarnlfntveqlqsvlpnchvpsnlstesllikfytnqnksadvtasdrhfsnrlyt
    yndkqlesilrgsqpgltmvngptrcgkhvlvckllevlqdtspndrtvvlsdsnfsmnt
    lftllekarcfhhllylsdegtlerygtlsswisklpgllreigrlaasiqapgshdasp
    dtalyfrdayikrlwekylntvdkdsvdaynrfpfhsyfgdkskrpietynkdnffdyat
    klygeleymfqqleeirpfgllryyedqelyalcqqsriigctwtslstrlgtlkekgfc
    fnnlivmnsqnisessitsillsnceptgfdrlvllgnqyngslfkrlrylksriidlnt
    qynvresisslcssiypldiktvdsspnkrldygnsgfahevqfinvgafkgsqetepvs
    gykqnlgeaeyavalfqymrmlgyptneivictlyesqvsllneiisvrcshnsffgqpa
    fvgtveklpkrvnfvifttveskeasdhwnpktfykafsacsyglyvlcnrdlfrstrgl
    eklwneiektpdklllttgeiypsshssvetfeienllhlsnyvvemtkkrlntn
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3jb9Y (Y:)
    msengleqevtveeknndvtekilvegekskeyeetprkvkivkrkkqparkqietrpey
    emepeqpgqvynlwynkwsggmrqdplksqvksetrcvisrdsgytkadknpgsffclyf
    argmcsegskceylhrlpkdtdffnanvdcfgrekhadyrddmggvgsflrqnytlyvgg
    itptddieeivsrhfaewgdierirvlnsrgiafitylneanaqfakeamahqsldhdec
    lnvrwattdpnpasqarnqrrleeraanavkkllpkqflldleetkngkxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9Y (Y:)
    parkqietrpeyemepeqpgqvynlwynkwsggmrqdplksqvksetrcvisrdsgytka
    dknpgsffclyfargmcsegskceylhrlpkdtdffnanvdcfgrekhadyrddmggvgs
    flrqnytlyvggitptddieeivsrhfaewgdierirvlnsrgiafitylneanaqfake
    amahqsleclnvrwattdpnpasqarnqrrleeraanavkkllpkqflldleetkngkxx
    xxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3jb9Z (Z:)
    mslcikllhetqghivtmelengstyrgklieaednmncqmrdisvtardgrvshldqvy
    irgshirflivpdmlrnapmfkvgpgrsvplptrgrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9Z (Z:)
    slcikllhetqghivtmelengstyrgklieaednmncqmrdisvtardgrvshldqvyi
    rgshirflivpdmlrnapmf
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    Sequence, based on SEQRES records: (download)
    >3jb9c (c:)
    mekekltnrtsthkfnetdretnhsrrhrhhhsrhreskhgrhdrserpssreagdrsrh
    erfskeplevkklpveneyfdskfasassmpsskdnpqnndftnslqgldfgtfgsriqr
    epidrksnkpgeifvgatlqnesststehkdieqleteinesginykigdngsrwrmmkl
    krvfdmaqdqrrpveevalerygslkefdfaleerdelelrkrtrkvqkevptgelyekr
    cadefktrkdsgngatyykvipdpsvnkdtptesdlnrlkadllraqlkkdpnyeslere
    yqkacddfenslhpsensnsqatipskkrnfddptidemvqeekllnkqrkygqnyeyak
    qiakdktysnnldyldenagklsnrmkrgdvslaqissggdlkkinhvldtcplclnyet
    qplapvislshrayvslptqpelakyhclivptghrintlscdedewdeirnfmkcialm
    fdsmnlgvifyenapspqrymhtaiecipvskrilslapayfrealstsdeewsqhrkii
    dtlegskkygkwafrkmmvkelgyfhvwfsidggyghvvedekawgrhdqvprqvfasml
    nlppevirrkgswtgkkdpredmfrsrfekfdwtkglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9c (c:)
    ptidemvqeekllnkqrkygqnyeyakqiakdktysnnldyldenagklsnrmkrgdvsl
    aqissggdlkkinhvldtcplclnyetqplapvislshrayvslptqpelakyhclivpt
    ghrintlscdedewdeirnfmkcialmfdsmnlgvifyenapspqrymhtaiecipvskr
    ilslapayfrealstsdeewsqhrkiidtlegskkygkwafrkmmvkelgyfhvwfsidg
    gyghvvedekawgrhdqvprqvfasmlnlppevirrkgswtgkkdpredmfrsrfekfdw
    

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    Sequence, based on SEQRES records: (download)
    >3jb9e (e:)
    mprlrtsrtkrppdgfdeieptliefqdrmrqientmgkgtktemlapifqlhhqrsryi
    ydlyykreaistelynwllkqnyadgnliakwkkpgyeklcclrciqtaeskfgstcicr
    vpkskldkdqrvrcthcgcngcascd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9e (e:)
    rlrtsrtkrppdgfdeieptliefqdrmrqientmgkgtktemlapifqlhhqrsryiyd
    lyykreaistelynwllkqnyadgnliakwkkpgyeklcclrciqtaeskfgstcicrvp
    kskldkdqrvrcthcgcngcascd
    

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    Sequence, based on SEQRES records: (download)
    >3jb9g (g:)
    mlvanyssdseeqensqspniqpllhtenlapavvdnvkddlivskggnsrelarnvpvn
    emvqpalgpanpfvtkeqdsiknsitgyaereyvpnfvfnqeyyanthaiygkrnfddne
    attstdlkrksqkikerredpgdpsilegdgaykgpwagygseqssspleyseyeevesl
    dvksekdtesnnlgqnellkeqlatpevethrskeetilhkdrlfdyqnrsymhvpndvg
    inlseepgeqtcyipkkhiftwkghtkgisclrffpisghlllsgsmdnqikiwevyhdr
    sllrtfqgharpirdlsfsqdgrsflstsfdktiklwdtelgkclncfnsdrltncvkfq
    vdpdkpneflagtadkrilqfdirspdivqaydhhlgginsitflengkrfvttsddssm
    rfweygtpvpikfvadiamhsmprvalrpngksiacqsldnciyvysayekyrqnkkkvf
    kgyscsgyslevgfspdgrfvfsgdssgnacfwdwktcklmaklpahsgpvqsmafhpqe
    tskvatssivdgsikywd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9g (g:)
    ensqspniqpllhtenlapavvdnvkddlivskggnsrelarnvpvnemvqpalgpanpf
    vtkeqdsiknsitgyaereyvpnfvfnqeyyanthaiygkrnfddneattstdlkrksqk
    ikerredpgdpsilegdgaykgpwagyg
    

  • Chain 'h':
    Sequence, based on SEQRES records: (download)
    >3jb9h (h:)
    mttahrpqfdparghsemaptritssralpahlklkyrqesqgteeevrkqdlreallra
    eaahfatqehgasseevsqnskliegftspstddkpnndvevdyqellrqtleadedasd
    sddsvdssnknsevsikrrktesnsqesvdssnsessdeesdsedetqqllrelenikqe
    rkreqmlqeeknraleqekrereiafgnellnkassgsfqvkrrwdedvvfrnthkgvdd
    tprpgfvndmlrsefhkkflarfvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9h (h:)
    tssralpahlklkyrqesqgteeevrkqdlreallraeaahfatqehrrwdedvvfrnth
    kgvddtprpgfvndmlrsefhkkflarfvd
    

  • Chain 'i':
    Sequence, based on SEQRES records: (download)
    >3jb9i (i:)
    msynisldslpyfestyneedrsaaaqiveeelkrsggllikqeeqkkkfqshrlsdrle
    naivaagkgeklaaidvqryiqlkppgtresllqsavvweyqksrndnlyllekhgekaf
    dsslealevqlellekelvntkklsqgcnrkrkhyqmevgarlaeaevkfgqllqssiqc
    rvatlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jb9i (i:)
    ldslpyfestyneedrsaaaqiveeelkrsgsdrlenaivaagkgeklaaidvqryiqlk
    ppgtresllqsavvweyqksrndnlyllekhgekafdsslealevqlellekelvntkkl
    sqgcnrkrkhyqmevgarlaeaevkfgqllqssiqcrvatl
    

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 'x':
    No sequence available.