Lineage for d3jb9b2 (3jb9 B:452-595)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793157Protein Pre-mRNA splicing factor Cwf10, domain II [346053] (1 species)
  7. 2793158Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346245] (1 PDB entry)
  8. 2793159Domain d3jb9b2: 3jb9 B:452-595 [344798]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9b2

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (B:) Pre-mRNA-splicing factor cwf10

SCOPe Domain Sequences for d3jb9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9b2 b.43.3.1 (B:452-595) Pre-mRNA splicing factor Cwf10, domain II {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
sprenaarkasqsyigpinssigkailemsreesaplvmhvtklyntvdannfyafarvy
sgqvkkgqkvkvlgenysledeedmvvahiaeicvpcaryrlhvdgavagmlvllggvdn
sisktativsdnlkddpyifrpia

SCOPe Domain Coordinates for d3jb9b2:

Click to download the PDB-style file with coordinates for d3jb9b2.
(The format of our PDB-style files is described here.)

Timeline for d3jb9b2: