SCOPe 2.08: Domain d6iczu1: 6icz u:22-243

Lineage for d6iczu1 (6icz u:22-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein automated matches [190301] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187108] (5 PDB entries)

8. Domain d6iczu1: 6icz u:22-243 [365954]
   Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczv_, d6iczy_
   automated match to d2hyic1
   complexed with atp, gtp, ihp, mg, zn

Details for d6iczu1

PDB Entry: 6icz, 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom

PDB Compounds: (u:) Eukaryotic initiation factor 4A-III

SCOPe Domain Sequences for d6iczu1:

Sequence; same for both SEQRES and ATOM records:

>d6iczu1 c.37.1.19 (u:22-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdviaq
sqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchaci
ggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeqi
ydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkr

Timeline for d6iczu1:

• d6iczu1 first appeared in SCOPe 2.07