Lineage for d6iczi_ (6icz i:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2380452Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 3065819Protein automated matches [365881] (1 species)
    not a true protein
  7. 3065820Species Homo sapiens [TaxId:9606] [365882] (3 PDB entries)
  8. 3065821Domain d6iczi_: 6icz i: [365883]
    Other proteins in same PDB: d6icza_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d1d3bl_
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczi_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (i:) Small nuclear ribonucleoprotein-associated protein

SCOPe Domain Sequences for d6iczi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczi_ b.38.1.1 (i:) automated matches {Homo sapiens [TaxId: 9606]}
gksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaeree
krvlglvllrgenlvsmtvegpppkd

SCOPe Domain Coordinates for d6iczi_:

Click to download the PDB-style file with coordinates for d6iczi_.
(The format of our PDB-style files is described here.)

Timeline for d6iczi_:

  • d6iczi_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-14