Lineage for d2hyic1 (2hyi C:22-243)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870805Protein Probable ATP-dependent RNA helicase DDX48 [142314] (1 species)
    Eukaryotic translation initiation factor 4A isoform 3
  7. 2870806Species Human (Homo sapiens) [TaxId:9606] [142315] (2 PDB entries)
    Uniprot P38919 22-243! Uniprot P38919 244-411
  8. 2870807Domain d2hyic1: 2hyi C:22-243 [136892]
    Other proteins in same PDB: d2hyia_, d2hyib_, d2hyic3, d2hyig_, d2hyih_, d2hyii3
    protein/RNA complex; complexed with anp, mg

Details for d2hyic1

PDB Entry: 2hyi (more details), 2.3 Å

PDB Description: Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA
PDB Compounds: (C:) Probable ATP-dependent RNA helicase DDX48

SCOPe Domain Sequences for d2hyic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyic1 c.37.1.19 (C:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}
dmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdviaq
sqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchaci
ggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeqi
ydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkr

SCOPe Domain Coordinates for d2hyic1:

Click to download the PDB-style file with coordinates for d2hyic1.
(The format of our PDB-style files is described here.)

Timeline for d2hyic1: