SCOP 1.73: Domain d2hyic1: 2hyi C:22-243

Lineage for d2hyic1 (2hyi C:22-243)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Probable ATP-dependent RNA helicase DDX48 [142314] (1 species)
   Eukaryotic translation initiation factor 4A isoform 3

7. Species Human (Homo sapiens) [TaxId:9606] [142315] (3 PDB entries)

8. Domain d2hyic1: 2hyi C:22-243 [136892]
   Other proteins in same PDB: d2hyia1, d2hyib1, d2hyig1, d2hyih1
   complexed with anp, mg; mutant

Details for d2hyic1

PDB Entry: 2hyi, 2.3 Å

PDB Description: Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA

PDB Compounds: (C:) Probable ATP-dependent RNA helicase DDX48

SCOP Domain Sequences for d2hyic1:

Sequence; same for both SEQRES and ATOM records:

>d2hyic1 c.37.1.19 (C:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}
dmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdviaq
sqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchaci
ggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeqi
ydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkr

Timeline for d2hyic1:

• d2hyic1 is new in SCOP 1.73
  
• d2hyic1 appears in SCOP 1.75
  
• d2hyic1 appears in the current release, SCOPe 2.08