![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein RNA-binding protein 8 [89938] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102978] (3 PDB entries) RBM8A, Y14 |
![]() | Domain d2hyih_: 2hyi H: [136895] Other proteins in same PDB: d2hyia_, d2hyic1, d2hyic2, d2hyic3, d2hyig_, d2hyii1, d2hyii2, d2hyii3 automated match to d1p27b_ protein/RNA complex; complexed with anp, mg |
PDB Entry: 2hyi (more details), 2.3 Å
SCOPe Domain Sequences for d2hyih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyih_ d.58.7.1 (H:) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]} pgpqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyet ykeaqaameglngqdlmgqpisvdwcfvrgp
Timeline for d2hyih_: