Lineage for d2hyih_ (2hyi H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952138Protein RNA-binding protein 8 [89938] (2 species)
  7. 2952144Species Human (Homo sapiens) [TaxId:9606] [102978] (3 PDB entries)
    RBM8A, Y14
  8. 2952148Domain d2hyih_: 2hyi H: [136895]
    Other proteins in same PDB: d2hyia_, d2hyic1, d2hyic2, d2hyic3, d2hyig_, d2hyii1, d2hyii2, d2hyii3
    automated match to d1p27b_
    protein/RNA complex; complexed with anp, mg

Details for d2hyih_

PDB Entry: 2hyi (more details), 2.3 Å

PDB Description: Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA
PDB Compounds: (H:) RNA-binding protein 8A

SCOPe Domain Sequences for d2hyih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyih_ d.58.7.1 (H:) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]}
pgpqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyet
ykeaqaameglngqdlmgqpisvdwcfvrgp

SCOPe Domain Coordinates for d2hyih_:

Click to download the PDB-style file with coordinates for d2hyih_.
(The format of our PDB-style files is described here.)

Timeline for d2hyih_: