Lineage for d6iczr1 (6icz r:3-59)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588606Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2588607Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2588743Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 2588744Protein automated matches [190242] (3 species)
    not a true protein
  7. 2588747Species Human (Homo sapiens) [TaxId:9606] [189860] (11 PDB entries)
  8. 3065879Domain d6iczr1: 6icz r:3-59 [365941]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq2, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d3jb9s1
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczr1

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (r:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d6iczr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczr1 g.44.1.0 (r:3-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvah

SCOPe Domain Coordinates for d6iczr1:

Click to download the PDB-style file with coordinates for d6iczr1.
(The format of our PDB-style files is described here.)

Timeline for d6iczr1:

  • d6iczr1 appears in periodic updates to SCOPe 2.07 starting on 2019-03-15