Lineage for d6iczt_ (6icz T:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399257Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2399432Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2399433Protein automated matches [190568] (7 species)
    not a true protein
  7. 2399473Species Human (Homo sapiens) [TaxId:9606] [187559] (55 PDB entries)
  8. 3065914Domain d6iczt_: 6icz T: [365976]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d4yvda_
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczt_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (T:) Pleiotropic regulator 1

SCOPe Domain Sequences for d6iczt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczt_ b.69.4.0 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tmpkpqwhppwklyrvisghlgwvrciavepgnqwfvtgsadrtikiwdlasgklklslt
ghistvrgvivstrspylfscgedkqvkcwdleynkvirhyhghlsavygldlhptidvl
vtcsrdstariwdvrtkasvhtlsghtnavatvrcqaaepqiitgshdttirlwdlvagk
trvtltnhkksvravvlhprhytfasgspdnikqwkfpdgsfiqnlsghnaiintltvns
dgvlvsgadngtmhlwdwrtgynfqrvhaavqpgsldsesgifacafdqsesrlltaead
ktikvyreddtat

SCOPe Domain Coordinates for d6iczt_:

Click to download the PDB-style file with coordinates for d6iczt_.
(The format of our PDB-style files is described here.)

Timeline for d6iczt_:

  • d6iczt_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-15