Lineage for d6iczc4 (6icz C:660-828)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931010Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries)
  8. 2931052Domain d6iczc4: 6icz C:660-828 [365950]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d3jb9b5
    complexed with atp, gtp, ihp, mg, zn

Details for d6iczc4

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6iczc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczc4 d.14.1.0 (C:660-828) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtfcetvvetsslkcfaetpnkknkitmiaeplekglaedienevvqitwnrkklgeffq
tkydwdllaarsiwafgpdatgpnilvddtlpsevdkallgsvkdsivqgfqwgtregpl
cdelirnvkfkildavvaqeplhrgggqiiptarrvvysaflmatprlm

SCOPe Domain Coordinates for d6iczc4:

Click to download the PDB-style file with coordinates for d6iczc4.
(The format of our PDB-style files is described here.)

Timeline for d6iczc4: