Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries) |
Domain d6iczc4: 6icz C:660-828 [365950] Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_ automated match to d3jb9b5 complexed with atp, gtp, ihp, mg, zn |
PDB Entry: 6icz (more details), 3 Å
SCOPe Domain Sequences for d6iczc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iczc4 d.14.1.0 (C:660-828) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtfcetvvetsslkcfaetpnkknkitmiaeplekglaedienevvqitwnrkklgeffq tkydwdllaarsiwafgpdatgpnilvddtlpsevdkallgsvkdsivqgfqwgtregpl cdelirnvkfkildavvaqeplhrgggqiiptarrvvysaflmatprlm
Timeline for d6iczc4:
View in 3D Domains from same chain: (mouse over for more information) d6iczc1, d6iczc2, d6iczc3, d6iczc5 |