Lineage for d6iczl_ (6icz l:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (14 species)
    not a true protein
  7. 2381143Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries)
  8. 3065873Domain d6iczl_: 6icz l: [365935]
    Other proteins in same PDB: d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6iczi_, d6iczj_, d6iczk_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d4f7uh_
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczl_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (l:) Small nuclear ribonucleoprotein E

SCOPe Domain Sequences for d6iczl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczl_ b.38.1.0 (l:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrkq
lgrimlkgdnitllqsvsn

SCOPe Domain Coordinates for d6iczl_:

Click to download the PDB-style file with coordinates for d6iczl_.
(The format of our PDB-style files is described here.)

Timeline for d6iczl_:

  • d6iczl_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-15