Lineage for d6iczo_ (6icz o:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435208Family c.10.2.4: U2A'-like [52068] (2 proteins)
    duplication: consists of 5-6 partly irregular repeats
  6. 3065805Protein automated matches [365867] (1 species)
    not a true protein
  7. 3065806Species Homo sapiens [TaxId:9606] [365868] (3 PDB entries)
  8. 3065807Domain d6iczo_: 6icz o: [365869]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d1a9nc_
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczo_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (o:) U2 small nuclear ribonucleoprotein A'

SCOPe Domain Sequences for d6iczo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczo_ c.10.2.4 (o:) automated matches {Homo sapiens [TaxId: 9606]}
vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
llrrlktllvnnnricrigegldqalpclteliltnnslvelgdldplaslksltylsil
rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk

SCOPe Domain Coordinates for d6iczo_:

Click to download the PDB-style file with coordinates for d6iczo_.
(The format of our PDB-style files is described here.)

Timeline for d6iczo_:

  • d6iczo_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-14