| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries) |
| Domain d6iczc1: 6icz C:56-439 [365947] Other proteins in same PDB: d6icza_, d6iczb_, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_ automated match to d3jb9b1 complexed with atp, gtp, ihp, mg, zn |
PDB Entry: 6icz (more details), 3 Å
SCOPe Domain Sequences for d6iczc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iczc1 c.37.1.0 (C:56-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlhedkkyyptaeevygpevetivqeedtqpltepiikpvktkkftlmeqtlpvtvye
mdfladlmdnselirnvtlcghlhhgktcfvdclieqthpeirkrydqdlcytdilfteq
ergvgikstpvtvvlpdtkgksylfnimdtpghvnfsdevtaglrisdgvvlfidaaegv
mlnterlikhavqerlavtvcinkidrlilelklpptdayyklrhivdevnglismystd
enlilspllgnvcfsssqysicftlgsfakiyadtfgdinyqefakrlwgdiyfnpktrk
ftkkaptsssqrsfvefileplykilaqvvgdvdtslprtldelgihltkeelklnirpl
lrlvckkffgeftgfvdmcvqhip
Timeline for d6iczc1:
View in 3DDomains from same chain: (mouse over for more information) d6iczc2, d6iczc3, d6iczc4, d6iczc5 |