Lineage for d6iczy_ (6icz y:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952621Domain d6iczy_: 6icz y: [365958]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_
    automated match to d3mdfa_
    complexed with atp, gtp, ihp, mg, zn

Details for d6iczy_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (y:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d6iczy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczy_ d.58.7.0 (y:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaai
dnmneselfgrtirvnlak

SCOPe Domain Coordinates for d6iczy_:

Click to download the PDB-style file with coordinates for d6iczy_.
(The format of our PDB-style files is described here.)

Timeline for d6iczy_: