![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
![]() | Domain d6iczy_: 6icz y: [365958] Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_ automated match to d3mdfa_ complexed with atp, gtp, ihp, mg, zn |
PDB Entry: 6icz (more details), 3 Å
SCOPe Domain Sequences for d6iczy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iczy_ d.58.7.0 (y:) automated matches {Human (Homo sapiens) [TaxId: 9606]} krvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaai dnmneselfgrtirvnlak
Timeline for d6iczy_:
![]() Domains from other chains: (mouse over for more information) d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_ |