Lineage for d6iczc2 (6icz C:440-581)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2386349Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2386350Protein automated matches [226946] (28 species)
    not a true protein
  7. 3065838Species Homo sapiens [TaxId:9606] [365900] (3 PDB entries)
  8. 3065886Domain d6iczc2: 6icz C:440-581 [365948]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d3jb9b2
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczc2

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6iczc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczc2 b.43.3.0 (C:440-581) automated matches {Homo sapiens [TaxId: 9606]}
spkvgakpkiehtytggvdsdlgeamsdcdpdgplmchttkmystddgvqfhafgrvlsg
tihagqpvkvlgenytledeedsqictvgrlwisvaryhievnrvpagnwvliegvdqpi
vktatiteprgneeaqifrplk

SCOPe Domain Coordinates for d6iczc2:

Click to download the PDB-style file with coordinates for d6iczc2.
(The format of our PDB-style files is described here.)

Timeline for d6iczc2:

  • d6iczc2 appears in periodic updates to SCOPe 2.07 starting on 2019-03-15