Lineage for d6iczr2 (6icz r:60-133)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591536Superfamily h.1.40: Pre-mRNA splicing factor Prp19 coiled coil domain [345934] (2 families) (S)
    Pfam PF08606
  5. 3065823Family h.1.40.0: automated matches [365885] (1 protein)
    not a true family
  6. 3065824Protein automated matches [365886] (1 species)
    not a true protein
  7. 3065825Species Homo sapiens [TaxId:9606] [365887] (3 PDB entries)
  8. 3065880Domain d6iczr2: 6icz r:60-133 [365942]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczr1, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d3jb9s2

Details for d6iczr2

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (r:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d6iczr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczr2 h.1.40.0 (r:60-133) automated matches {Homo sapiens [TaxId: 9606]}
pirpkppsatsipailkalqdewdavmlhsftlrqqlqttrqelshalyqhdaacrviar
ltkevtaarealat

SCOPe Domain Coordinates for d6iczr2:

Click to download the PDB-style file with coordinates for d6iczr2.
(The format of our PDB-style files is described here.)

Timeline for d6iczr2:

  • d6iczr2 appears in periodic updates to SCOPe 2.07 starting on 2019-03-15