Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Pre-mRNA splicing factor Cwf10, N-terminal domain [346068] (1 species) |
Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346286] (1 PDB entry) |
Domain d3jb9b1: 3jb9 B:68-451 [344797] Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ protein/RNA complex; complexed with adp, gdp, mg, zn has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3jb9 (more details), 3.6 Å
SCOPe Domain Sequences for d3jb9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jb9b1 c.37.1.8 (B:68-451) Pre-mRNA splicing factor Cwf10, N-terminal domain {Schizosaccharomyces pombe 972h- [TaxId: 284812]} avvlhedkqyypsaeevygsnvdimvqeqdtqplsqpiiepirhkriaiettnvpdtvyk keflfglltgtddvrsfivaghlhhgksalldllvyythpdtkppkrrslrytdthyler ervmsikstpltlavsdmkgktfafqcidtpghvdfvdevaapmaisdgvvlvvdviegv minttriikhailhdmpivlvlnkvdrlilelrlppndayhklrhvidevndnicqiskd lkyrvspelgnvcfascdlgycftlssfaklyidrhggidvdlfskrlwgdiyfdsktrk fakqsldgsgvrsfvhfileplyklhtltisdeaeklkkhlssfqiylkpkdylldpkpl lqlicasffgfpvgfvnavtrhip
Timeline for d3jb9b1:
View in 3D Domains from same chain: (mouse over for more information) d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5 |
View in 3D Domains from other chains: (mouse over for more information) d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ |