Lineage for d6iczh_ (6icz h:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (14 species)
    not a true protein
  7. 2381143Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries)
  8. 3065870Domain d6iczh_: 6icz h: [365932]
    Other proteins in same PDB: d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6iczi_, d6iczj_, d6iczk_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d3jcmj_
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczh_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (h:) Small nuclear ribonucleoprotein Sm D3

SCOPe Domain Sequences for d6iczh_:

Sequence, based on SEQRES records: (download)

>d6iczh_ b.38.1.0 (h:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
irgskirflilpdmlknapmlks

Sequence, based on observed residues (ATOM records): (download)

>d6iczh_ b.38.1.0 (h:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
irgskirflilpdmlknmlks

SCOPe Domain Coordinates for d6iczh_:

Click to download the PDB-style file with coordinates for d6iczh_.
(The format of our PDB-style files is described here.)

Timeline for d6iczh_:

  • d6iczh_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-15