Lineage for d6iczu2 (6icz u:244-407)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451114Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2451348Protein automated matches [190301] (5 species)
    not a true protein
  7. 2451354Species Human (Homo sapiens) [TaxId:9606] [187108] (4 PDB entries)
  8. 3065893Domain d6iczu2: 6icz u:244-407 [365955]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczv_, d6iczy_
    automated match to d2hyic2
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczu2

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (u:) Eukaryotic initiation factor 4A-III

SCOPe Domain Sequences for d6iczu2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczu2 c.37.1.19 (u:244-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft
vssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyih
rigrsgrygrkgvainfvknddirilrdieqyystqidempmnv

SCOPe Domain Coordinates for d6iczu2:

Click to download the PDB-style file with coordinates for d6iczu2.
(The format of our PDB-style files is described here.)

Timeline for d6iczu2:

  • d6iczu2 appears in periodic updates to SCOPe 2.07 starting on 2019-03-15