Lineage for d6iczv_ (6icz v:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564820Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 2564821Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
    automatically mapped to Pfam PF02792
  5. 2564822Family d.232.1.1: Mago nashi protein [89818] (2 proteins)
  6. 3065910Protein automated matches [365972] (1 species)
    not a true protein
  7. 3065911Species Homo sapiens [TaxId:9606] [365973] (1 PDB entry)
  8. 3065912Domain d6iczv_: 6icz v: [365974]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczy_
    automated match to d2hyia_

Details for d6iczv_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (v:) Protein mago nashi homolog 2

SCOPe Domain Sequences for d6iczv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczv_ d.232.1.1 (v:) automated matches {Homo sapiens [TaxId: 9606]}
sdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkr
iiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvf
yylvqdlkclvfsliglhfkikpi

SCOPe Domain Coordinates for d6iczv_:

Click to download the PDB-style file with coordinates for d6iczv_.
(The format of our PDB-style files is described here.)

Timeline for d6iczv_:

  • d6iczv_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-15