Lineage for d2fugc2 (2fug C:247-685)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140572Protein NADH-quinone oxidoreductase chain 3, Nqo3 [142751] (1 species)
  7. 2140573Species Thermus thermophilus [TaxId:274] [142752] (1 PDB entry)
    Uniprot Q56223 247-685
  8. 2140575Domain d2fugc2: 2fug C:247-685 [134139]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 3:247-685
    complexed with fes, fmn, sf4

Details for d2fugc2

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (C:) NADH-quinone oxidoreductase chain 3

SCOPe Domain Sequences for d2fugc2:

Sequence, based on SEQRES records: (download)

>d2fugc2 c.81.1.1 (C:247-685) NADH-quinone oxidoreductase chain 3, Nqo3 {Thermus thermophilus [TaxId: 274]}
wemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghewadqnrl
ktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllaselakalkt
phldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdlkpphry
nhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillallgdkeg
semvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaanarglea
mgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpapt
fyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhleaqkalka
rkvpeamgrlsfrlkelrp

Sequence, based on observed residues (ATOM records): (download)

>d2fugc2 c.81.1.1 (C:247-685) NADH-quinone oxidoreductase chain 3, Nqo3 {Thermus thermophilus [TaxId: 274]}
wemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghewadqnrl
ktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllaselakalkt
phldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdlkpphry
nhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillallgdkeg
semvakakeawekaknpvlilgagvlqdtvaaerarllaerakvlamtpaanargleamg
vlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfy
ekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhleaqkalkark
vpeamgrlsfrlkelrp

SCOPe Domain Coordinates for d2fugc2:

Click to download the PDB-style file with coordinates for d2fugc2.
(The format of our PDB-style files is described here.)

Timeline for d2fugc2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1