Lineage for d2fugu3 (2fug U:1-95)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159971Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 protein domains)
  6. 2160059Protein Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain [142982] (1 species)
  7. 2160060Species Thermus thermophilus [TaxId:274] [142983] (1 PDB entry)
    Uniprot Q56223 1-95
  8. 2160064Domain d2fugu3: 2fug U:1-95 [134166]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 3:1-95
    complexed with fes, fmn, sf4

Details for d2fugu3

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (U:) NADH-quinone oxidoreductase chain 3

SCOPe Domain Sequences for d2fugu3:

Sequence, based on SEQRES records: (download)

>d2fugu3 d.15.4.2 (U:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
gkpllnekgepeiqwqpklaascvtavadgmvvdt

Sequence, based on observed residues (ATOM records): (download)

>d2fugu3 d.15.4.2 (U:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvrigliqwqpk
laascvtavadgmvvdt

SCOPe Domain Coordinates for d2fugu3:

Click to download the PDB-style file with coordinates for d2fugu3.
(The format of our PDB-style files is described here.)

Timeline for d2fugu3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1