SCOPe 2.08: Domain d2fugj3: 2fug J:250-333

Lineage for d2fugj3 (2fug J:250-333)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families)
   possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster

5. Family d.15.13.1: Nqo1 middle domain-like [142985] (1 protein)
   C-terminal part of Pfam PF01512

6. Protein NADH-quinone oxidoreductase chain 1, Nqo1 [142986] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142987] (1 PDB entry)
   Uniprot Q56222 250-333

8. Domain d2fugj3: 2fug J:250-333 [134149]
   Other proteins in same PDB: d2fug11, d2fug12, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
   automatically matched to 2FUG 1:250-333
   complexed with fes, fmn, sf4

Details for d2fugj3

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (J:) NADH-quinone oxidoreductase chain 1

SCOPe Domain Sequences for d2fugj3:

Sequence; same for both SEQRES and ATOM records:

>d2fugj3 d.15.13.1 (J:250-333) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]}
klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt
pmsyehlqakgsmlgtggvilipe

Timeline for d2fugj3:

• d2fugj3 first appeared in SCOP 1.73
  
• d2fugj3 appears in SCOPe 2.07