![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.307: Nqo5-like [143242] (1 superfamily) core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel |
![]() | Superfamily d.307.1: Nqo5-like [143243] (1 family) ![]() |
![]() | Family d.307.1.1: Nqo5-like [143244] (2 proteins) Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329 |
![]() | Protein NADH-quinone oxidoreductase chain 5, Nqo5 [143245] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143246] (1 PDB entry) Uniprot Q56219 1-196 |
![]() | Domain d2fugw1: 2fug W:1-196 [134169] Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugx1, d2fugy1, d2fugz1 automatically matched to 2FUG 5:1-196 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fugw1:
Sequence, based on SEQRES records: (download)
>d2fugw1 d.307.1.1 (W:1-196) NADH-quinone oxidoreductase chain 5, Nqo5 {Thermus thermophilus [TaxId: 274]} mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg ltfykggsrkgyrslw
>d2fugw1 d.307.1.1 (W:1-196) NADH-quinone oxidoreductase chain 5, Nqo5 {Thermus thermophilus [TaxId: 274]} mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdnflerevydlfgiv feghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpgltfyk ggsrkgyrslw
Timeline for d2fugw1:
![]() Domains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugx1, d2fugy1, d2fugz1 |