Lineage for d2fugx1 (2fug X:15-175)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. Family e.19.1.2: Nq06-like [144031] (2 proteins)
    Pfam PF01058
  6. Protein NAD-quinone oxidoreductase chain 6, Nqo6 [144032] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [144033] (1 PDB entry)
    Uniprot Q56218 14-174
  8. Domain d2fugx1: 2fug X:15-175 [134170]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugy1, d2fugz1
    automatically matched to 2FUG 6:15-175
    complexed with fes, fmn, sf4

Details for d2fugx1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (X:) NADH-quinone oxidoreductase chain 6

SCOPe Domain Sequences for d2fugx1:

Sequence, based on SEQRES records: (download)

>d2fugx1 e.19.1.2 (X:15-175) NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus thermophilus [TaxId: 274]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarndlarfgsevfrasprq
advmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvd
vyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaa

Sequence, based on observed residues (ATOM records): (download)

>d2fugx1 e.19.1.2 (X:15-175) NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus thermophilus [TaxId: 274]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
mqlqkkvrgqaynergerlppvaa

SCOPe Domain Coordinates for d2fugx1 are not available.

Timeline for d2fugx1: