Lineage for d2fugh1 (2fug H:3-129)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527780Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2527817Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 2527852Family d.82.2.2: Nqo15-like [143572] (1 protein)
    overall structural similarity to the frataxin-like family
    automatically mapped to Pfam PF11497
  6. 2527853Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species)
  7. 2527854Species Thermus thermophilus [TaxId:274] [143574] (4 PDB entries)
    Uniprot Q5SKZ7 3-129
  8. 2527864Domain d2fugh1: 2fug H:3-129 [134146]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1
    automatically matched to 2FUG 7:3-129
    complexed with fes, fmn, sf4

Details for d2fugh1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (H:) conserved hypothetical protein

SCOPe Domain Sequences for d2fugh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fugh1 d.82.2.2 (H:3-129) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]}
asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
realafa

SCOPe Domain Coordinates for d2fugh1:

Click to download the PDB-style file with coordinates for d2fugh1.
(The format of our PDB-style files is described here.)

Timeline for d2fugh1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1