SCOPe 2.08: Domain d2fugl4: 2fug L:96-246

Lineage for d2fugl4 (2fug L:96-246)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 [143254] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143255] (1 PDB entry)
   Uniprot Q56223 96-246

8. Domain d2fugl4: 2fug L:96-246 [134154]
   Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
   automatically matched to 2FUG 3:96-246
   complexed with fes, fmn, sf4

Details for d2fugl4

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (L:) NADH-quinone oxidoreductase chain 3

SCOPe Domain Sequences for d2fugl4:

Sequence, based on SEQRES records:

>d2fugl4 d.58.1.5 (L:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvyt
rfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmd
fglpsgfsgnitdicpvgalldltarfrarn

Sequence, based on observed residues (ATOM records):

>d2fugl4 d.58.1.5 (L:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyeklpvytrfeftrrh
vdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfs
gnitdicpvgalldltarfrarn

Timeline for d2fugl4:

• d2fugl4 first appeared in SCOP 1.73
  
• d2fugl4 appears in SCOPe 2.07