Lineage for d2fugv1 (2fug V:35-409)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. Family e.18.1.2: Nqo4-like [144028] (2 proteins)
    Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit
  6. Protein NADH-quinone oxidoreductase chain 4, Nqo4 [144029] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [144030] (1 PDB entry)
    Uniprot Q56220 35-409
  8. Domain d2fugv1: 2fug V:35-409 [134168]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 4:35-409
    complexed with fes, fmn, sf4

Details for d2fugv1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (V:) NADH-quinone oxidoreductase chain 4

SCOPe Domain Sequences for d2fugv1:

Sequence, based on SEQRES records: (download)

>d2fugv1 e.18.1.2 (V:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]}
psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
yerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdvfd
rmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyteg
fhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmv
aiiasldpvmgdvdr

Sequence, based on observed residues (ATOM records): (download)

>d2fugv1 e.18.1.2 (V:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]}
psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
yerargvgvippevaidlgltggslrasgvnydvrkaypysgydvplgergdvfdrmlvr
iremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhytegfhppk
gevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiias
ldpvmgdvdr

SCOPe Domain Coordinates for d2fugv1 are not available.

Timeline for d2fugv1: