Lineage for d2fugf1 (2fug F:15-175)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019185Family e.19.1.2: Nq06-like [144031] (2 proteins)
    Pfam PF01058
  6. 3019186Protein NAD-quinone oxidoreductase chain 6, Nqo6 [144032] (1 species)
  7. 3019187Species Thermus thermophilus [TaxId:274] [144033] (1 PDB entry)
    Uniprot Q56218 14-174
  8. 3019189Domain d2fugf1: 2fug F:15-175 [134144]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugy1, d2fugz1
    automatically matched to 2FUG 6:15-175
    complexed with fes, fmn, sf4

Details for d2fugf1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (F:) NADH-quinone oxidoreductase chain 6

SCOPe Domain Sequences for d2fugf1:

Sequence, based on SEQRES records: (download)

>d2fugf1 e.19.1.2 (F:15-175) NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus thermophilus [TaxId: 274]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarndlarfgsevfrasprq
advmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvd
vyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaa

Sequence, based on observed residues (ATOM records): (download)

>d2fugf1 e.19.1.2 (F:15-175) NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus thermophilus [TaxId: 274]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
mqlqkkvrgqaynergerlppvaa

SCOPe Domain Coordinates for d2fugf1:

Click to download the PDB-style file with coordinates for d2fugf1.
(The format of our PDB-style files is described here.)

Timeline for d2fugf1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1