Lineage for d2fugm1 (2fug M:35-409)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573281Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2573282Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2573409Family e.18.1.2: Nqo4-like [144028] (2 proteins)
    Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit
  6. 2573410Protein NADH-quinone oxidoreductase chain 4, Nqo4 [144029] (1 species)
  7. 2573411Species Thermus thermophilus [TaxId:274] [144030] (1 PDB entry)
    Uniprot Q56220 35-409
  8. 2573414Domain d2fugm1: 2fug M:35-409 [134155]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 4:35-409
    complexed with fes, fmn, sf4

Details for d2fugm1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (M:) NADH-quinone oxidoreductase chain 4

SCOPe Domain Sequences for d2fugm1:

Sequence, based on SEQRES records: (download)

>d2fugm1 e.18.1.2 (M:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]}
psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
yerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdvfd
rmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyteg
fhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmv
aiiasldpvmgdvdr

Sequence, based on observed residues (ATOM records): (download)

>d2fugm1 e.18.1.2 (M:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]}
psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
yerargvgvippevaidlgltggslrasgvnydvrkaypysgydvplgergdvfdrmlvr
iremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhytegfhppk
gevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiias
ldpvmgdvdr

SCOPe Domain Coordinates for d2fugm1:

Click to download the PDB-style file with coordinates for d2fugm1.
(The format of our PDB-style files is described here.)

Timeline for d2fugm1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1