Lineage for d2fug61 (2fug 6:15-175)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222239Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2222240Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2222363Family e.19.1.2: Nq06-like [144031] (2 protein domains)
    Pfam PF01058
  6. 2222364Protein NAD-quinone oxidoreductase chain 6, Nqo6 [144032] (1 species)
  7. 2222365Species Thermus thermophilus [TaxId:274] [144033] (1 PDB entry)
    Uniprot Q56218 14-174
  8. 2222366Domain d2fug61: 2fug 6:15-175 [134131]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugy1, d2fugz1
    complexed with fes, fmn, sf4

Details for d2fug61

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (6:) NADH-quinone oxidoreductase chain 6

SCOPe Domain Sequences for d2fug61:

Sequence, based on SEQRES records: (download)

>d2fug61 e.19.1.2 (6:15-175) NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus thermophilus [TaxId: 274]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarndlarfgsevfrasprq
advmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvd
vyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaa

Sequence, based on observed residues (ATOM records): (download)

>d2fug61 e.19.1.2 (6:15-175) NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus thermophilus [TaxId: 274]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
mqlqkkvrgqaynergerlppvaa

SCOPe Domain Coordinates for d2fug61:

Click to download the PDB-style file with coordinates for d2fug61.
(The format of our PDB-style files is described here.)

Timeline for d2fug61:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1