PDB entry 2fug

View 2fug on RCSB PDB site
Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus
Class: oxidoreductase
Keywords: oxidoreductase, electron transport, respiratory chain
Deposited on 2006-01-26, released 2006-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.265
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: NADH-quinone oxidoreductase chain 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fug11, d2fug12, d2fug13
  • Chain '2':
    Compound: NADH-quinone oxidoreductase chain 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fug21
  • Chain '3':
    Compound: NADH-quinone oxidoreductase chain 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fug31, d2fug32, d2fug33, d2fug34
  • Chain '4':
    Compound: NADH-quinone oxidoreductase chain 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fug41
  • Chain '5':
    Compound: NADH-quinone oxidoreductase chain 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fug51
  • Chain '6':
    Compound: NADH-quinone oxidoreductase chain 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fug61
  • Chain '7':
    Compound: conserved hypothetical protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB BAD70319 (Start-128)
    Domains in SCOPe 2.06: d2fug71
  • Chain '9':
    Compound: NADH-quinone oxidoreductase chain 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fug91
  • Chain 'A':
    Compound: NADH-quinone oxidoreductase chain 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fuga1, d2fuga2, d2fuga3
  • Chain 'B':
    Compound: NADH-quinone oxidoreductase chain 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugb1
  • Chain 'C':
    Compound: NADH-quinone oxidoreductase chain 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugc1, d2fugc2, d2fugc3, d2fugc4
  • Chain 'D':
    Compound: NADH-quinone oxidoreductase chain 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugd1
  • Chain 'E':
    Compound: NADH-quinone oxidoreductase chain 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fuge1
  • Chain 'F':
    Compound: NADH-quinone oxidoreductase chain 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugf1
  • Chain 'G':
    Compound: NADH-quinone oxidoreductase chain 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugg1
  • Chain 'H':
    Compound: conserved hypothetical protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB BAD70319 (Start-128)
    Domains in SCOPe 2.06: d2fugh1
  • Chain 'J':
    Compound: NADH-quinone oxidoreductase chain 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugj1, d2fugj2, d2fugj3
  • Chain 'K':
    Compound: NADH-quinone oxidoreductase chain 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugk1
  • Chain 'L':
    Compound: NADH-quinone oxidoreductase chain 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugl1, d2fugl2, d2fugl3, d2fugl4
  • Chain 'M':
    Compound: NADH-quinone oxidoreductase chain 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugm1
  • Chain 'N':
    Compound: NADH-quinone oxidoreductase chain 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugn1
  • Chain 'O':
    Compound: NADH-quinone oxidoreductase chain 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugo1
  • Chain 'P':
    Compound: NADH-quinone oxidoreductase chain 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugp1
  • Chain 'Q':
    Compound: conserved hypothetical protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB BAD70319 (Start-128)
    Domains in SCOPe 2.06: d2fugq1
  • Chain 'S':
    Compound: NADH-quinone oxidoreductase chain 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugs1, d2fugs2, d2fugs3
  • Chain 'T':
    Compound: NADH-quinone oxidoreductase chain 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugt1
  • Chain 'U':
    Compound: NADH-quinone oxidoreductase chain 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugu1, d2fugu2, d2fugu3, d2fugu4
  • Chain 'V':
    Compound: NADH-quinone oxidoreductase chain 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugv1
  • Chain 'W':
    Compound: NADH-quinone oxidoreductase chain 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugw1
  • Chain 'X':
    Compound: NADH-quinone oxidoreductase chain 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugx1
  • Chain 'Y':
    Compound: NADH-quinone oxidoreductase chain 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fugy1
  • Chain 'Z':
    Compound: conserved hypothetical protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB BAD70319 (Start-128)
    Domains in SCOPe 2.06: d2fugz1
  • Heterogens: SF4, FES, FMN

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2fug1 (1:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fug1 (1:)
    sgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsglrgrg
    gagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmilagyair
    atvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayicgeet
    almnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqmgteqs
    kgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteev
    ldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcregvagf
    mvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqylalar
    ekrpvprpslwr
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2fug2 (2:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fug2 (2:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >2fug3 (3:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fug3 (3:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvrigliqwqpk
    laascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyg
    lyeklpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfierg
    vhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgcgit
    adtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatweeaf
    lalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfppas
    ledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermprrtd
    kmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknpvli
    lgagvlqdtvaaerarllaerakvlamtpaanargleamgvlpgakgaswdepgalyayy
    gfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlplspap
    iengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkelrpker
    kgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearvvhr
    edvpkghlylsalgpaa
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2fug4 (4:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fug4 (4:)
    psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
    layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
    tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
    yerargvgvippevaidlgltggslrasgvnydvrkaypysgydvplgergdvfdrmlvr
    iremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhytegfhppk
    gevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiias
    ldpvmgdvdr
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2fug5 (5:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fug5 (5:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdnflerevydlfgiv
    feghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpgltfyk
    ggsrkgyrslw
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >2fug6 (6:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fug6 (6:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
    mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
    mqlqkkvrgqaynergerlppvaa
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >2fug7 (7:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fug7 (7:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >2fug9 (9:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fug9 (9:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fugA (A:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugA (A:)
    sgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsglrgrg
    gagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmilagyair
    atvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayicgeet
    almnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqmgteqs
    kgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteev
    ldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcregvagf
    mvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqylalar
    ekrpvprpslwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fugB (B:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugB (B:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fugC (C:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugC (C:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvrigliqwqpk
    laascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyg
    lyeklpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfierg
    vhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgcgit
    adtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatweeaf
    lalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfppas
    ledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermprrtd
    kmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknpvli
    lgagvlqdtvaaerarllaerakvlamtpaanargleamgvlpgakgaswdepgalyayy
    gfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlplspap
    iengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkelrpker
    kgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearvvhr
    edvpkghlylsalgpaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fugD (D:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugD (D:)
    psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
    layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
    tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
    yerargvgvippevaidlgltggslrasgvnydvrkaypysgydvplgergdvfdrmlvr
    iremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhytegfhppk
    gevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiias
    ldpvmgdvdr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fugE (E:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugE (E:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdnflerevydlfgiv
    feghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpgltfyk
    ggsrkgyrslw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fugF (F:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugF (F:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
    mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
    mqlqkkvrgqaynergerlppvaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2fugG (G:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugG (G:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fugH (H:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugH (H:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2fugJ (J:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugJ (J:)
    sgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsglrgrg
    gagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmilagyair
    atvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayicgeet
    almnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqmgteqs
    kgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteev
    ldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcregvagf
    mvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqylalar
    ekrpvprpslwr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2fugK (K:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugK (K:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2fugL (L:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugL (L:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvrigliqwqpk
    laascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyg
    lyeklpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfierg
    vhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgcgit
    adtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatweeaf
    lalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfppas
    ledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermprrtd
    kmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknpvli
    lgagvlqdtvaaerarllaerakvlamtpaanargleamgvlpgakgaswdepgalyayy
    gfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlplspap
    iengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkelrpker
    kgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearvvhr
    edvpkghlylsalgpaa
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2fugM (M:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugM (M:)
    psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
    layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
    tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
    yerargvgvippevaidlgltggslrasgvnydvrkaypysgydvplgergdvfdrmlvr
    iremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhytegfhppk
    gevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiias
    ldpvmgdvdr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2fugN (N:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugN (N:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdnflerevydlfgiv
    feghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpgltfyk
    ggsrkgyrslw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2fugO (O:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugO (O:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
    mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
    mqlqkkvrgqaynergerlppvaa
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2fugP (P:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugP (P:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2fugQ (Q:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugQ (Q:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2fugS (S:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugS (S:)
    sgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsglrgrg
    gagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmilagyair
    atvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayicgeet
    almnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqmgteqs
    kgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteev
    ldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcregvagf
    mvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqylalar
    ekrpvprpslwr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2fugT (T:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugT (T:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2fugU (U:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugU (U:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvrigliqwqpk
    laascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyg
    lyeklpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfierg
    vhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgcgit
    adtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatweeaf
    lalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfppas
    ledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermprrtd
    kmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknpvli
    lgagvlqdtvaaerarllaerakvlamtpaanargleamgvlpgakgaswdepgalyayy
    gfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlplspap
    iengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkelrpker
    kgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearvvhr
    edvpkghlylsalgpaa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2fugV (V:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugV (V:)
    psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
    layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
    tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
    yerargvgvippevaidlgltggslrasgvnydvrkaypysgydvplgergdvfdrmlvr
    iremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhytegfhppk
    gevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiias
    ldpvmgdvdr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2fugW (W:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugW (W:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdnflerevydlfgiv
    feghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpgltfyk
    ggsrkgyrslw
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2fugX (X:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugX (X:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
    mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
    mqlqkkvrgqaynergerlppvaa
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2fugY (Y:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugY (Y:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2fugZ (Z:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fugZ (Z:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa