Lineage for d2fugd1 (2fug D:35-409)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018743Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 3018744Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 3018889Family e.18.1.2: Nqo4-like [144028] (2 proteins)
    Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit
  6. 3018890Protein NADH-quinone oxidoreductase chain 4, Nqo4 [144029] (1 species)
  7. 3018891Species Thermus thermophilus [TaxId:274] [144030] (1 PDB entry)
    Uniprot Q56220 35-409
  8. 3018893Domain d2fugd1: 2fug D:35-409 [134142]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 4:35-409
    complexed with fes, fmn, sf4

Details for d2fugd1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (D:) NADH-quinone oxidoreductase chain 4

SCOPe Domain Sequences for d2fugd1:

Sequence, based on SEQRES records: (download)

>d2fugd1 e.18.1.2 (D:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]}
psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
yerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdvfd
rmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyteg
fhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmv
aiiasldpvmgdvdr

Sequence, based on observed residues (ATOM records): (download)

>d2fugd1 e.18.1.2 (D:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]}
psthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfahd
layalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafrere
tildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaespif
yerargvgvippevaidlgltggslrasgvnydvrkaypysgydvplgergdvfdrmlvr
iremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhytegfhppk
gevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiias
ldpvmgdvdr

SCOPe Domain Coordinates for d2fugd1:

Click to download the PDB-style file with coordinates for d2fugd1.
(The format of our PDB-style files is described here.)

Timeline for d2fugd1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1