Lineage for d2fugu1 (2fug U:686-767)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802680Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2802717Protein NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain [141393] (1 species)
    topoisomer of the common fold, lacking the second psi loop
  7. 2802718Species Thermus thermophilus [TaxId:274] [141394] (1 PDB entry)
    Uniprot Q56223 686-767
  8. 2802722Domain d2fugu1: 2fug U:686-767 [134164]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 3:686-767
    complexed with fes, fmn, sf4

    missing some secondary structures that made up less than one-third of the common domain

Details for d2fugu1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (U:) NADH-quinone oxidoreductase chain 3

SCOPe Domain Sequences for d2fugu1:

Sequence, based on SEQRES records: (download)

>d2fugu1 b.52.2.2 (U:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea
rvvhredvpkghlylsalgpaa

Sequence, based on observed residues (ATOM records): (download)

>d2fugu1 b.52.2.2 (U:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearv
vhredvpkghlylsalgpaa

SCOPe Domain Coordinates for d2fugu1:

Click to download the PDB-style file with coordinates for d2fugu1.
(The format of our PDB-style files is described here.)

Timeline for d2fugu1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1