Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) automatically mapped to Pfam PF02532 |
Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [327744] (4 PDB entries) |
Domain d5tisi_: 5tis I: [327758] Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_ automated match to d4ub8i_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5tis (more details), 2.25 Å
SCOPe Domain Sequences for d5tisi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tisi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 197221]} metlkitvyivvtffvllfvfgflsgdparnpkrkdl
Timeline for d5tisi_: