SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tism_ (5tis M:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227401Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2227402Family f.23.35.1: PsbM-like [161034] (2 protein domains)
    Pfam PF05151
  6. 2227403Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 2227404Species Thermosynechococcus elongatus [TaxId:146786] [161036] (6 PDB entries)
    Uniprot Q8DHA7 1-36
  8. 2283985Domain d5tism_: 5tis M: [327286]
    Other proteins in same PDB: d5tisc_, d5tisj_, d5tisk_, d5tisl_
    automated match to d2axtm1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tism_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5tism_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tism_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesqq

SCOPe Domain Coordinates for d5tism_:

Click to download the PDB-style file with coordinates for d5tism_.
(The format of our PDB-style files is described here.)

Timeline for d5tism_:

  • d5tism_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-16