SCOPe 2.06: Domain d5tish

SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tish_ (5tis H:)

Root: SCOPe 2.06
Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family)
automatically mapped to Pfam PF00737
Family f.23.33.1: PsbH-like [161026] (2 protein domains)
Pfam PF00737
Protein automated matches [191001] (3 species)
not a true protein
Species Thermosynechococcus elongatus [TaxId:197221] [327761] (2 PDB entries)

Domain d5tish_: 5tis H: [327774]
Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tise_, d5tisf_, d5tisi_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
automated match to d2axth1
complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tish_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5tish_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tish_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d5tish_:

Click to download the PDB-style file with coordinates for d5tish_.
(The format of our PDB-style files is described here.)

Timeline for d5tish_: