SCOPe 2.07: Domain d5tish_: 5tis H:

Lineage for d5tish_ (5tis H:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 protein domains)
   Pfam PF00737

6. Protein automated matches [191001] (4 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [327761] (3 PDB entries)

8. Domain d5tish_: 5tis H: [327774]
   Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
   automated match to d2axth1
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tish_

PDB Entry: 5tis, 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5tish_:

Sequence; same for both SEQRES and ATOM records:

>d5tish_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

Timeline for d5tish_:

• d5tish_ first appeared in SCOPe 2.06