| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein automated matches [190224] (17 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries) |
| Domain d5tisa_: 5tis A: [327728] Other proteins in same PDB: d5tisb_, d5tisc_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_ automated match to d2axta1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5tis (more details), 2.25 Å
SCOPe Domain Sequences for d5tisa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tisa_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs
llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq
welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh
nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva
ahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidak
gnvintwadiinranlgmevmhernahnfpldla
Timeline for d5tisa_: