SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tisa_ (5tis A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2227758Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2227759Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2227760Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. 2227944Protein automated matches [190224] (8 species)
    not a true protein
  7. 2228031Species Thermosynechococcus elongatus [TaxId:197221] [260543] (4 PDB entries)
  8. 2284427Domain d5tisa_: 5tis A: [327728]
    Other proteins in same PDB: d5tisb_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axta1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisa_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (A:) Photosystem II protein D1 1

SCOPe Domain Sequences for d5tisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisa_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs
llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq
welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh
nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva
ahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidak
gnvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d5tisa_:

Click to download the PDB-style file with coordinates for d5tisa_.
(The format of our PDB-style files is described here.)

Timeline for d5tisa_:

  • d5tisa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29