SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tisl_ (5tis l:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227335Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2227336Family f.23.31.1: PsbL-like [161018] (2 protein domains)
    Pfam PF02419
  6. 2227337Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 2227338Species Thermosynechococcus elongatus [TaxId:146786] [161020] (4 PDB entries)
    Uniprot Q8DIN8 1-37
  8. 2283993Domain d5tisl_: 5tis l: [327294]
    Other proteins in same PDB: d5tisc_, d5tisj_, d5tisk_, d5tism_
    automated match to d2axtl1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisl_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5tisl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d5tisl_:

Click to download the PDB-style file with coordinates for d5tisl_.
(The format of our PDB-style files is described here.)

Timeline for d5tisl_:

  • d5tisl_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-16