Lineage for d5tisl_ (5tis l:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227335Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2227336Family f.23.31.1: PsbL-like [161018] (2 protein domains)
    Pfam PF02419
  6. 2227337Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 2227338Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries)
    Uniprot Q8DIN8 1-37
  8. 2283993Domain d5tisl_: 5tis l: [327294]
    Other proteins in same PDB: d5tisc_, d5tisj_, d5tisk_, d5tism_
    automated match to d2axtl1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisl_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5tisl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d5tisl_:

Click to download the PDB-style file with coordinates for d5tisl_.
(The format of our PDB-style files is described here.)

Timeline for d5tisl_:

  • d5tisl_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-16