Lineage for d5tisl_ (5tis l:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026391Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 3026392Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 3026393Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 3026394Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries)
    Uniprot Q8DIN8 1-37
  8. 3026395Domain d5tisl_: 5tis l: [327294]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axtl1
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisl_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5tisl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d5tisl_:

Click to download the PDB-style file with coordinates for d5tisl_.
(The format of our PDB-style files is described here.)

Timeline for d5tisl_: