Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) automatically mapped to Pfam PF01405 |
Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161032] (11 PDB entries) Uniprot Q8DIQ0 1-30 |
Domain d5tist_: 5tis T: [327784] Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tisu_, d5tisv_, d5tisx_, d5tisz_ automated match to d3bz2t_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5tis (more details), 2.25 Å
SCOPe Domain Sequences for d5tist_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tist_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]} metityvfifaciialfffaiffrepprit
Timeline for d5tist_: